Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1251
Gene name
LocationContig_13:187106..191953
Strand+
Gene length (bp)4847
Transcript length (bp)4503
Coding sequence length (bp)4503
Protein length (aa) 1501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 4.7E-111 773 1393
PF18086 PPIP5K2_N Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain 4.8E-36 301 388
PF08443 RimK RimK-like ATP-grasp domain 1.7E-07 522 614

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 766 1453 5.0E-171
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 295 658 8.0E-143
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 299 651 2.0E-133
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 769 1175 9.0E-94
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 300 639 4.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 766 1453 5.0E-171
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 295 658 8.0E-143
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 299 651 2.0E-133
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 769 1175 9.0E-94
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 300 639 4.0E-88
sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 300 639 4.0E-88
sp|Q6ZQB6|VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus GN=Ppip5k2 PE=1 SV=3 300 639 8.0E-88
sp|Q5XHF8|VIP2_XENLA Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Xenopus laevis GN=ppip5k2 PE=2 SV=1 295 639 2.0E-87
sp|Q6PFW1|VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens GN=PPIP5K1 PE=1 SV=1 300 639 2.0E-86
sp|A7Z050|VIP1_BOVIN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Bos taurus GN=PPIP5K1 PE=2 SV=1 300 639 2.0E-86
sp|A2ARP1|VIP1_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Mus musculus GN=Ppip5k1 PE=1 SV=1 300 639 2.0E-85
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 300 639 2.0E-85
sp|P0C644|VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus GN=Ppip5k1 PE=1 SV=1 300 639 2.0E-85
sp|Q9VR59|VIP1_DROME Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Drosophila melanogaster GN=l(1)G0196 PE=1 SV=2 300 639 5.0E-84
sp|P91309|VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans GN=F46F11.1 PE=3 SV=3 292 638 4.0E-81
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 1266 1453 3.0E-55
sp|A7Z050|VIP1_BOVIN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Bos taurus GN=PPIP5K1 PE=2 SV=1 1268 1372 1.0E-13
sp|P0C644|VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus GN=Ppip5k1 PE=1 SV=1 1268 1372 5.0E-13
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 773 1158 6.0E-13
sp|A2ARP1|VIP1_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Mus musculus GN=Ppip5k1 PE=1 SV=1 1268 1372 1.0E-12
sp|Q6PFW1|VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens GN=PPIP5K1 PE=1 SV=1 1268 1372 2.0E-12
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 1268 1372 7.0E-12
sp|Q5XHF8|VIP2_XENLA Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Xenopus laevis GN=ppip5k2 PE=2 SV=1 1268 1396 2.0E-11
sp|Q6ZQB6|VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus GN=Ppip5k2 PE=1 SV=3 1268 1372 2.0E-11
sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 1268 1372 2.0E-11
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 1268 1372 2.0E-11
sp|Q9VR59|VIP1_DROME Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Drosophila melanogaster GN=l(1)G0196 PE=1 SV=2 1264 1372 7.0E-11
sp|P91309|VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans GN=F46F11.1 PE=3 SV=3 1266 1398 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1673
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3652
Ophiocordyceps australis map64 (Brazil) OphauB2|1251 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02737
Ophiocordyceps camponoti-rufipedis Ophun1|1569
Ophiocordyceps kimflemingae Ophio5|8399
Ophiocordyceps subramaniannii Hirsu2|1427

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1251
MEHSPSIPFSSPADPSFRRGHPLVGPCSLSSDASPAEPSLHLHRQLQQCQHGLSHSRSISSSSVASWQSRQSPAE
RFSAGPLLVAKSPSRSQHQPATSDACSEVLVFGEPQLSSSTDDTDTPRIRPGLSSSPDSTALTFLPEPALVSRPS
LPPRNHSRHLSVNSIYSLFSARRIMTSPPSTQGSDVGGAPRSVSSIVSTTAGGSVNSEAVVASPCSAQASQPPMG
GQQQMASREPLAQPSELIKRNQRGDGSLRSQPDRSRSRAKRRFSGSTAASSHSPSSERGPHHRDKEETKPATWGV
IGICALDVKARSKPSRNILNRLIAQREFDVVVFGDKVILDEEVENWPICDYLISFYSDGFPLEKAIAYVKARKPF
CVNDVPMQKILWDRRVCLRLLDKINVRTPKRLEVSRDGGPKMLTAEMAKHIKEVSGVSLTPVDANDGPQRPQVQL
VEEGDVLSVDGVSLRKPFVEKPTSGEDHNIMIYFPNSSGGGARKLFRKIGNKSSDYVPDLNVPRVLTEPDSSYIY
ESFMQVDNAEDVKAYTVGPQYCHAETRKSPVVDGIVRRNTHGKEVRYVTSLTPEEKDMASKISSAFGQRVCGFDL
LRASGKSYVIDVNGWSFVKDNDDYYEHCALILKDIFVKERLRRGGVSPPLPSPAASEVDPLARAALAIKEREQQA
SAAPVHKASPPDVEQQASHVAGRCSEVPTKSKSDGAIDCMGQSSEPSPLLPVPPPDLTASNAHSAASSVKTWSVV
PPGTHAPEQQSSPAPPPPKHSWKLKGMVTVIRHADRTPKQKYKFTFHTEPFIALLKGHQEEVLLVGEAALASVIQ
AVDVAHEAGVEDQGKLKALRNVLVKKGSWAGTKVQIKPMFRKRSADEVSAADMGKRAVSTPIREHVEGKSAPCNR
RHDSLSGVTMSKFTAAEEQLVLDKLQLIVKWGGEPTHSARYQSQELGENMRNDLKLLNRDILDEVHVYSSSERRV
TASAQIWAASFLGRKDIGEDFITIRKDLLDDSNAAKDEMDKVKKKLKGLLRKGNERPAEFAWPDNMPEPSEVQTR
VVQLMNFHRRVMQYNYAKLYNGSAPSLGSISNASAEKLAADNSTASLSSLSHANAINSIQSRWCSGEDAELFRER
WEKLFSEFCDGEKVDPSKISELYDTMKFDALHNRQFLEWVFLPPKMMLDEEYMAAKEARKSRDHDESRGPDEQQR
QHPSPDASDKSDSSGRGGSVKKLFHRRSFLNGIRHLNEEGPPEQYFRLFKGVHQPPTKADARNDPLQELYRLAKV
LFDFICPQEYGISDTEKLEIGLLTSLPLLKEIVQDLEEMQASNDAKSFFYFTKESHIYTLLNCIIEGGIETKIKR
STIPELDYLSQICFELYESETKPSDAGVEGDETTFAYSIRITISPGCHVFDPLHVQLDSRHCIGCAPRRSLTPHI
DWLQVIKTLRAKFNQVKLPKTFLAVNLSEAFTFEEQERLANDDGLEMKMAPPKDLLSSASAAQAEDSAAPGHQPA
*
Coding >OphauB2|1251
ATGGAGCACTCCCCTTCCATTCCTTTCTCGTCGCCCGCCGACCCCTCCTTCCGGCGCGGCCACCCGTTGGTTGGG
CCTTGCTCTCTCTCGTCCGACGCCTCGCCGGCTGAGCCGTCTCTTCACCTCCACCGCCAGCTGCAACAGTGCCAG
CATGGTCTGTCGCATTCTCGCAGCATATCCTCGTCTTCTGTTGCCAGTTGGCAGAGCCGTCAGAGCCCCGCTGAA
CGATTCTCTGCCGGCCCACTATTGGTGGCGAAATCGCCGTCGCGTAGCCAGCACCAACCGGCCACTTCAGACGCT
TGCAGTGAAGTCCTCGTCTTTGGCGAGCCGCAACTCTCCTCCTCCACCGACGACACGGACACGCCGAGAATCCGC
CCGGGCTTGAGTTCAAGTCCCGATTCGACAGCTTTGACTTTTCTACCCGAGCCTGCTTTGGTCTCGAGACCCTCT
CTCCCCCCTCGAAACCACTCGAGACATCTTTCCGTCAATTCCATTTATTCCTTGTTCTCTGCTCGCCGCATCATG
ACTTCGCCACCCTCGACCCAGGGCTCAGATGTCGGAGGCGCCCCCAGGTCTGTCTCGAGCATTGTTTCCACCACT
GCTGGCGGCTCTGTAAACTCTGAAGCTGTTGTTGCCTCTCCATGCAGCGCCCAGGCTAGCCAGCCCCCCATGGGA
GGACAGCAGCAAATGGCGTCTCGCGAACCCTTGGCCCAGCCATCAGAGCTTATAAAGCGAAATCAGCGTGGCGAT
GGCAGTCTACGCTCCCAGCCCGATCGCTCCCGCAGCCGAGCAAAGCGAAGATTCAGCGGTAGCACCGCCGCGAGC
AGCCACAGCCCGAGCAGCGAGCGTGGACCGCACCATCGCGACAAGGAAGAGACCAAACCAGCCACGTGGGGAGTT
ATCGGTATATGCGCTCTCGATGTCAAGGCCAGGAGCAAGCCGAGCAGAAACATCCTCAACCGCCTAATTGCCCAG
CGGGAATTCGACGTTGTGGTTTTTGGAGACAAGGTGATACTTGATGAAGAGGTTGAGAACTGGCCAATCTGCGAC
TACTTGATATCATTCTACTCGGACGGATTTCCTTTGGAAAAGGCAATTGCCTATGTCAAGGCGCGAAAGCCTTTC
TGCGTCAATGACGTGCCTATGCAGAAGATTCTGTGGGACCGGAGAGTCTGCCTCCGCCTCCTCGACAAGATCAAT
GTGCGGACGCCCAAACGACTCGAGGTCAGCCGTGACGGCGGACCCAAGATGCTGACAGCCGAAATGGCCAAGCAT
ATCAAGGAAGTGTCGGGAGTCAGCCTGACGCCTGTGGATGCAAATGATGGGCCACAACGGCCGCAAGTCCAGCTT
GTTGAAGAGGGCGATGTGCTGAGCGTGGATGGCGTGTCGCTGCGAAAGCCCTTTGTTGAAAAGCCGACGAGCGGC
GAAGACCACAACATTATGATATATTTTCCAAACAGCTCTGGTGGCGGCGCCAGGAAGCTTTTTCGAAAAATCGGC
AACAAAAGCTCCGACTATGTGCCCGACCTCAATGTGCCGCGAGTGCTGACGGAGCCTGACAGCAGCTACATTTAC
GAGAGCTTTATGCAAGTCGACAATGCAGAAGACGTCAAGGCGTACACGGTGGGGCCTCAGTACTGCCACGCAGAG
ACGCGCAAGTCGCCCGTTGTTGACGGCATTGTGCGCCGCAACACGCATGGCAAGGAAGTTCGCTATGTCACGTCG
CTGACGCCCGAGGAAAAGGACATGGCAAGCAAAATCTCGTCTGCCTTTGGGCAGAGGGTCTGTGGCTTTGATTTG
CTTCGGGCTTCGGGCAAGAGCTACGTAATTGATGTCAATGGATGGAGCTTCGTCAAGGACAATGACGACTACTAC
GAGCACTGCGCTCTGATTCTCAAGGACATTTTTGTCAAGGAGAGGCTGCGGCGCGGGGGCGTGAGTCCTCCCCTG
CCCTCGCCAGCAGCGTCCGAGGTAGATCCTCTGGCGCGCGCCGCCCTGGCCATCAAGGAGCGCGAGCAGCAAGCC
TCTGCGGCGCCTGTGCACAAGGCGAGTCCTCCAGACGTTGAGCAGCAGGCCAGCCATGTAGCTGGTCGCTGCAGC
GAAGTGCCGACCAAGTCCAAGAGCGATGGCGCCATTGACTGCATGGGACAAAGCTCGGAGCCAAGCCCCTTGCTG
CCGGTGCCGCCTCCGGACCTGACAGCATCCAATGCCCATTCAGCTGCCTCGTCTGTCAAGACGTGGTCGGTGGTG
CCCCCGGGCACTCATGCTCCCGAGCAACAAAGCAGCCCCGCTCCGCCGCCGCCCAAGCACTCGTGGAAGCTCAAG
GGCATGGTGACGGTGATACGCCACGCCGACCGCACGCCCAAGCAAAAGTACAAGTTCACCTTCCACACGGAGCCC
TTTATCGCCCTCCTCAAGGGGCACCAAGAAGAGGTGCTGTTGGTGGGAGAAGCGGCTCTGGCCAGCGTCATTCAG
GCCGTCGACGTGGCGCACGAGGCGGGCGTGGAAGACCAAGGCAAGCTCAAGGCGCTGCGAAACGTGCTCGTCAAG
AAGGGCAGCTGGGCCGGGACCAAGGTGCAGATCAAGCCCATGTTTCGCAAGCGGAGTGCCGATGAAGTCTCGGCG
GCCGATATGGGCAAAAGGGCAGTCAGCACGCCCATTAGAGAGCACGTCGAGGGCAAGAGCGCGCCTTGCAACCGC
CGGCACGACTCGCTGTCGGGCGTCACCATGTCCAAGTTCACGGCTGCCGAGGAGCAGCTGGTGCTGGACAAGCTG
CAGCTCATTGTCAAGTGGGGGGGCGAGCCGACACACTCGGCACGCTACCAGTCGCAGGAGCTGGGCGAGAACATG
CGCAACGACCTCAAGCTGCTCAACCGCGACATTCTCGACGAGGTGCACGTCTATAGCAGCTCGGAGCGGCGCGTG
ACGGCGAGTGCGCAAATCTGGGCCGCGTCGTTTCTCGGCCGCAAGGACATTGGCGAGGACTTCATCACGATCCGC
AAGGACCTCTTGGACGACTCCAACGCGGCCAAGGACGAGATGGACAAGGTCAAGAAGAAGCTCAAGGGCCTGCTG
CGCAAGGGAAACGAGCGCCCCGCCGAGTTTGCCTGGCCCGACAACATGCCGGAGCCGTCCGAGGTGCAGACGAGG
GTGGTGCAACTCATGAATTTCCACCGCCGCGTCATGCAGTACAACTATGCAAAGCTCTACAATGGCTCTGCGCCC
TCGCTGGGCTCCATTTCCAACGCCAGCGCCGAGAAGCTGGCGGCAGACAACTCGACGGCGTCGCTGTCGTCGCTG
TCCCACGCCAATGCCATCAACAGCATCCAGTCGCGCTGGTGCAGCGGCGAGGACGCGGAGCTGTTTCGGGAGCGC
TGGGAAAAGCTCTTTAGCGAGTTTTGCGATGGCGAAAAGGTGGATCCTAGCAAGATCTCGGAGCTCTACGACACG
ATGAAGTTTGACGCCTTGCACAACCGCCAGTTCCTCGAATGGGTCTTCTTGCCGCCCAAGATGATGCTGGACGAG
GAATACATGGCGGCCAAGGAGGCTCGCAAATCAAGGGACCATGACGAGAGCCGCGGGCCCGACGAGCAGCAGCGC
CAGCACCCTTCGCCCGATGCATCTGACAAGTCTGACTCGTCGGGCCGCGGCGGCTCAGTCAAGAAGCTCTTCCAC
CGCCGCTCCTTTCTCAACGGCATCCGCCACCTCAACGAAGAGGGCCCGCCCGAGCAGTACTTTCGCCTCTTCAAG
GGCGTCCACCAGCCCCCCACAAAGGCGGATGCGCGAAACGATCCACTGCAGGAACTCTACCGCCTGGCCAAGGTG
CTCTTTGACTTCATCTGCCCTCAGGAATACGGCATTTCAGACACGGAGAAGCTCGAGATTGGCCTGCTGACGTCG
CTGCCTCTGCTCAAGGAGATTGTCCAGGACCTGGAGGAGATGCAGGCCTCCAACGACGCAAAGTCCTTCTTCTAC
TTTACCAAGGAGTCGCACATTTACACCCTGCTCAACTGCATCATTGAAGGCGGCATCGAGACCAAGATTAAGCGC
AGCACCATTCCCGAGCTCGACTACCTGTCTCAGATTTGCTTTGAGCTGTACGAGTCGGAGACGAAGCCCTCGGAT
GCGGGCGTCGAGGGCGACGAAACCACGTTTGCCTATAGCATCCGCATCACCATTAGCCCGGGCTGCCACGTCTTT
GACCCTCTGCACGTCCAGCTGGACAGCCGCCACTGCATAGGCTGCGCTCCCCGGCGCAGCTTGACGCCACACATT
GACTGGCTGCAAGTCATCAAGACGCTGCGCGCCAAATTTAATCAGGTCAAGCTGCCAAAGACATTTCTAGCCGTC
AACCTATCAGAGGCCTTTACCTTTGAGGAACAGGAACGCCTGGCCAACGACGACGGGCTCGAGATGAAGATGGCG
CCGCCCAAGGATCTGCTGTCGAGCGCGTCTGCTGCCCAAGCTGAGGACAGTGCTGCGCCTGGGCACCAGCCGGCC
TGA
Transcript >OphauB2|1251
ATGGAGCACTCCCCTTCCATTCCTTTCTCGTCGCCCGCCGACCCCTCCTTCCGGCGCGGCCACCCGTTGGTTGGG
CCTTGCTCTCTCTCGTCCGACGCCTCGCCGGCTGAGCCGTCTCTTCACCTCCACCGCCAGCTGCAACAGTGCCAG
CATGGTCTGTCGCATTCTCGCAGCATATCCTCGTCTTCTGTTGCCAGTTGGCAGAGCCGTCAGAGCCCCGCTGAA
CGATTCTCTGCCGGCCCACTATTGGTGGCGAAATCGCCGTCGCGTAGCCAGCACCAACCGGCCACTTCAGACGCT
TGCAGTGAAGTCCTCGTCTTTGGCGAGCCGCAACTCTCCTCCTCCACCGACGACACGGACACGCCGAGAATCCGC
CCGGGCTTGAGTTCAAGTCCCGATTCGACAGCTTTGACTTTTCTACCCGAGCCTGCTTTGGTCTCGAGACCCTCT
CTCCCCCCTCGAAACCACTCGAGACATCTTTCCGTCAATTCCATTTATTCCTTGTTCTCTGCTCGCCGCATCATG
ACTTCGCCACCCTCGACCCAGGGCTCAGATGTCGGAGGCGCCCCCAGGTCTGTCTCGAGCATTGTTTCCACCACT
GCTGGCGGCTCTGTAAACTCTGAAGCTGTTGTTGCCTCTCCATGCAGCGCCCAGGCTAGCCAGCCCCCCATGGGA
GGACAGCAGCAAATGGCGTCTCGCGAACCCTTGGCCCAGCCATCAGAGCTTATAAAGCGAAATCAGCGTGGCGAT
GGCAGTCTACGCTCCCAGCCCGATCGCTCCCGCAGCCGAGCAAAGCGAAGATTCAGCGGTAGCACCGCCGCGAGC
AGCCACAGCCCGAGCAGCGAGCGTGGACCGCACCATCGCGACAAGGAAGAGACCAAACCAGCCACGTGGGGAGTT
ATCGGTATATGCGCTCTCGATGTCAAGGCCAGGAGCAAGCCGAGCAGAAACATCCTCAACCGCCTAATTGCCCAG
CGGGAATTCGACGTTGTGGTTTTTGGAGACAAGGTGATACTTGATGAAGAGGTTGAGAACTGGCCAATCTGCGAC
TACTTGATATCATTCTACTCGGACGGATTTCCTTTGGAAAAGGCAATTGCCTATGTCAAGGCGCGAAAGCCTTTC
TGCGTCAATGACGTGCCTATGCAGAAGATTCTGTGGGACCGGAGAGTCTGCCTCCGCCTCCTCGACAAGATCAAT
GTGCGGACGCCCAAACGACTCGAGGTCAGCCGTGACGGCGGACCCAAGATGCTGACAGCCGAAATGGCCAAGCAT
ATCAAGGAAGTGTCGGGAGTCAGCCTGACGCCTGTGGATGCAAATGATGGGCCACAACGGCCGCAAGTCCAGCTT
GTTGAAGAGGGCGATGTGCTGAGCGTGGATGGCGTGTCGCTGCGAAAGCCCTTTGTTGAAAAGCCGACGAGCGGC
GAAGACCACAACATTATGATATATTTTCCAAACAGCTCTGGTGGCGGCGCCAGGAAGCTTTTTCGAAAAATCGGC
AACAAAAGCTCCGACTATGTGCCCGACCTCAATGTGCCGCGAGTGCTGACGGAGCCTGACAGCAGCTACATTTAC
GAGAGCTTTATGCAAGTCGACAATGCAGAAGACGTCAAGGCGTACACGGTGGGGCCTCAGTACTGCCACGCAGAG
ACGCGCAAGTCGCCCGTTGTTGACGGCATTGTGCGCCGCAACACGCATGGCAAGGAAGTTCGCTATGTCACGTCG
CTGACGCCCGAGGAAAAGGACATGGCAAGCAAAATCTCGTCTGCCTTTGGGCAGAGGGTCTGTGGCTTTGATTTG
CTTCGGGCTTCGGGCAAGAGCTACGTAATTGATGTCAATGGATGGAGCTTCGTCAAGGACAATGACGACTACTAC
GAGCACTGCGCTCTGATTCTCAAGGACATTTTTGTCAAGGAGAGGCTGCGGCGCGGGGGCGTGAGTCCTCCCCTG
CCCTCGCCAGCAGCGTCCGAGGTAGATCCTCTGGCGCGCGCCGCCCTGGCCATCAAGGAGCGCGAGCAGCAAGCC
TCTGCGGCGCCTGTGCACAAGGCGAGTCCTCCAGACGTTGAGCAGCAGGCCAGCCATGTAGCTGGTCGCTGCAGC
GAAGTGCCGACCAAGTCCAAGAGCGATGGCGCCATTGACTGCATGGGACAAAGCTCGGAGCCAAGCCCCTTGCTG
CCGGTGCCGCCTCCGGACCTGACAGCATCCAATGCCCATTCAGCTGCCTCGTCTGTCAAGACGTGGTCGGTGGTG
CCCCCGGGCACTCATGCTCCCGAGCAACAAAGCAGCCCCGCTCCGCCGCCGCCCAAGCACTCGTGGAAGCTCAAG
GGCATGGTGACGGTGATACGCCACGCCGACCGCACGCCCAAGCAAAAGTACAAGTTCACCTTCCACACGGAGCCC
TTTATCGCCCTCCTCAAGGGGCACCAAGAAGAGGTGCTGTTGGTGGGAGAAGCGGCTCTGGCCAGCGTCATTCAG
GCCGTCGACGTGGCGCACGAGGCGGGCGTGGAAGACCAAGGCAAGCTCAAGGCGCTGCGAAACGTGCTCGTCAAG
AAGGGCAGCTGGGCCGGGACCAAGGTGCAGATCAAGCCCATGTTTCGCAAGCGGAGTGCCGATGAAGTCTCGGCG
GCCGATATGGGCAAAAGGGCAGTCAGCACGCCCATTAGAGAGCACGTCGAGGGCAAGAGCGCGCCTTGCAACCGC
CGGCACGACTCGCTGTCGGGCGTCACCATGTCCAAGTTCACGGCTGCCGAGGAGCAGCTGGTGCTGGACAAGCTG
CAGCTCATTGTCAAGTGGGGGGGCGAGCCGACACACTCGGCACGCTACCAGTCGCAGGAGCTGGGCGAGAACATG
CGCAACGACCTCAAGCTGCTCAACCGCGACATTCTCGACGAGGTGCACGTCTATAGCAGCTCGGAGCGGCGCGTG
ACGGCGAGTGCGCAAATCTGGGCCGCGTCGTTTCTCGGCCGCAAGGACATTGGCGAGGACTTCATCACGATCCGC
AAGGACCTCTTGGACGACTCCAACGCGGCCAAGGACGAGATGGACAAGGTCAAGAAGAAGCTCAAGGGCCTGCTG
CGCAAGGGAAACGAGCGCCCCGCCGAGTTTGCCTGGCCCGACAACATGCCGGAGCCGTCCGAGGTGCAGACGAGG
GTGGTGCAACTCATGAATTTCCACCGCCGCGTCATGCAGTACAACTATGCAAAGCTCTACAATGGCTCTGCGCCC
TCGCTGGGCTCCATTTCCAACGCCAGCGCCGAGAAGCTGGCGGCAGACAACTCGACGGCGTCGCTGTCGTCGCTG
TCCCACGCCAATGCCATCAACAGCATCCAGTCGCGCTGGTGCAGCGGCGAGGACGCGGAGCTGTTTCGGGAGCGC
TGGGAAAAGCTCTTTAGCGAGTTTTGCGATGGCGAAAAGGTGGATCCTAGCAAGATCTCGGAGCTCTACGACACG
ATGAAGTTTGACGCCTTGCACAACCGCCAGTTCCTCGAATGGGTCTTCTTGCCGCCCAAGATGATGCTGGACGAG
GAATACATGGCGGCCAAGGAGGCTCGCAAATCAAGGGACCATGACGAGAGCCGCGGGCCCGACGAGCAGCAGCGC
CAGCACCCTTCGCCCGATGCATCTGACAAGTCTGACTCGTCGGGCCGCGGCGGCTCAGTCAAGAAGCTCTTCCAC
CGCCGCTCCTTTCTCAACGGCATCCGCCACCTCAACGAAGAGGGCCCGCCCGAGCAGTACTTTCGCCTCTTCAAG
GGCGTCCACCAGCCCCCCACAAAGGCGGATGCGCGAAACGATCCACTGCAGGAACTCTACCGCCTGGCCAAGGTG
CTCTTTGACTTCATCTGCCCTCAGGAATACGGCATTTCAGACACGGAGAAGCTCGAGATTGGCCTGCTGACGTCG
CTGCCTCTGCTCAAGGAGATTGTCCAGGACCTGGAGGAGATGCAGGCCTCCAACGACGCAAAGTCCTTCTTCTAC
TTTACCAAGGAGTCGCACATTTACACCCTGCTCAACTGCATCATTGAAGGCGGCATCGAGACCAAGATTAAGCGC
AGCACCATTCCCGAGCTCGACTACCTGTCTCAGATTTGCTTTGAGCTGTACGAGTCGGAGACGAAGCCCTCGGAT
GCGGGCGTCGAGGGCGACGAAACCACGTTTGCCTATAGCATCCGCATCACCATTAGCCCGGGCTGCCACGTCTTT
GACCCTCTGCACGTCCAGCTGGACAGCCGCCACTGCATAGGCTGCGCTCCCCGGCGCAGCTTGACGCCACACATT
GACTGGCTGCAAGTCATCAAGACGCTGCGCGCCAAATTTAATCAGGTCAAGCTGCCAAAGACATTTCTAGCCGTC
AACCTATCAGAGGCCTTTACCTTTGAGGAACAGGAACGCCTGGCCAACGACGACGGGCTCGAGATGAAGATGGCG
CCGCCCAAGGATCTGCTGTCGAGCGCGTCTGCTGCCCAAGCTGAGGACAGTGCTGCGCCTGGGCACCAGCCGGCC
TGA
Gene >OphauB2|1251
ATGGAGCACTCCCCTTCCATTCCTTTCTCGTCGCCCGCCGACCCCTCCTTCCGGCGCGGCCACCCGTTGGTTGGG
CCTTGCTCTCTCTCGTCCGACGCCTCGCCGGCTGAGCCGTCTCTTCACCTCCACCGCCAGCTGCAACAGTGCCAG
CATGGTCTGTCGCATTCTCGCAGCATATCCTCGTCTTCTGTTGCCAGTTGGCAGAGCCGTCAGAGCCCCGCTGAA
CGATTCTCTGCCGGCCCACTATTGGTGGCGAAATCGCCGTCGCGTAGCCAGCACCAACCGGCCACTTCAGACGCT
TGCAGTGAAGTCCTCGTCTTTGGCGAGCCGCAACTCTCCTCCTCCACCGACGACACGGACACGCCGAGAATCCGC
CCGGGCTTGAGTTCAAGTCCCGATTCGACAGCTTTGACTTTTCTACCCGAGCCTGCTTTGGTCTCGAGACCCTCT
CTCCCCCCTCGAAACCACTCGAGACATCTTTCCGTCAATTCCATTTATTCCTTGTTCTCTGCTCGCCGCATCATG
ACTTCGCCACCCTCGACCCAGGGCTCAGATGTCGGAGGCGCCCCCAGGTCTGTCTCGAGCATTGTTTCCACCACT
GCTGGCGGCTCTGTAAACTCTGAAGCTGTTGTTGCCTCTCCATGCAGCGCCCAGGCTAGCCAGCCCCCCATGGGA
GGACAGCAGCAAATGGCGTCTCGCGAACCCTTGGCCCAGCCATCAGAGCTTATAAAGCGAAATCAGCGTGGCGAT
GGCAGTCTACGCTCCCAGCCCGATCGCTCCCGCAGCCGAGCAAAGCGAAGATTCAGCGGTAGCACCGCCGCGAGC
AGCCACAGCCCGAGCAGCGAGCGTGGACCGCACCATCGCGACAAGGAAGAGAGTAAGCCAAGATGAAGAGGAGCA
ATTGGGCCGTGTATGAGCAAGCATTGACGCGCCTAGTAGCCAAACCAGCCACGTGGGGAGTTATCGGTATATGCG
CTCTCGATGTCAAGGCCAGGAGCAAGCCGAGCAGAAACATCCTCAACCGCCTAATTGCCCAGCGGGAATTCGACG
TTGTGGTTTTTGGAGACAAGGTGATACTTGATGAAGGTATGTCATGGCAATCGTCTTGTTAGACGGTCAATGGGC
GGCAGCTGACGGCGAGTCGTCAGAGGTTGAGAACTGGCCAATCTGGTAAGTCGTCGGTGGTGTCTCAGTCAAAAA
AGAGCTCATTGCAAGGTGACTAACGTGGATTTCAGCGACTACTTGATATCATTCTACTCGGACGGATTTCCTTTG
GAAAAGGCAATTGCCTATGTCAAGGCGCGAAAGCCTTTCTGCGTCAATGACGTGCCTATGCAGAAGATTCTGTGG
GACCGGAGAGTCTGCCTCCGCCTCCTCGACAAGATCAATGTGCGGACGCCCAAACGACTCGAGGTCAGCCGTGAC
GGCGGACCCAAGATGCTGACAGCCGAAATGGCCAAGCATATCAAGGAAGTGTCGGGAGTCAGCCTGACGCCTGTG
GATGCAAATGATGGGCCACAACGGCCGCAAGTCCAGCTTGTTGAAGAGGGCGATGTGCTGAGCGTGGATGGCGTG
TCGCTGCGAAAGCCCTTTGTTGAAAAGCCGACGAGCGGCGAAGACCACAACATTATGATATATTTTCCAAACAGC
TCTGGTGGCGGCGCCAGGAAGCTTTTTCGAAAAATCGGCAACAAAAGCTCCGACTATGTGCCCGACCTCAATGTG
CCGCGAGTGCTGACGGAGCCTGACAGCAGCTACATTTACGAGAGCTTTATGCAAGTCGACAATGCAGAAGACGTC
AAGGCGTACACGGTGGGGCCTCAGTACTGCCACGCAGAGACGCGCAAGTCGCCCGTTGTTGACGGCATTGTGCGC
CGCAACACGCATGGCAAGGAAGTTCGCTATGTCACGTCGCTGACGCCCGAGGAAAAGGACATGGCAAGCAAAATC
TCGTCTGCCTTTGGGCAGAGGGTCTGTGGCTTTGATTTGCTTCGGGCTTCGGGCAAGAGCTACGTAATTGATGTC
AATGGATGGAGCTTCGTCAAGGACAATGACGACTACTACGAGCACTGCGCTCTGATTCTCAAGGACATTTTTGTC
AAGGAGAGGCTGCGGCGCGGGGGCGTGAGTCCTCCCCTGCCCTCGCCAGCAGCGTCCGAGGTAGATCCTCTGGCG
CGCGCCGCCCTGGCCATCAAGGAGCGCGAGCAGCAAGCCTCTGCGGCGCCTGTGCACAAGGCGAGTCCTCCAGAC
GTTGAGCAGCAGGCCAGCCATGTAGCTGGTCGCTGCAGCGAAGTGCCGACCAAGTCCAAGAGCGATGGCGCCATT
GACTGCATGGGACAAAGCTCGGAGCCAAGCCCCTTGCTGCCGGTGCCGCCTCCGGACCTGACAGCATCCAATGCC
CATTCAGCTGCCTCGTCTGTCAAGACGTGGTCGGTGGTGCCCCCGGGCACTCATGCTCCCGAGCAACAAAGCAGC
CCCGCTCCGCCGCCGCCCAAGCACTCGTGGAAGCTCAAGGGCATGGTGACGGTGATACGCCACGCCGACCGCACG
CCCAAGCAAAAGTACAAGTTCACCTTCCACACGGAGCCCTTTATCGCCCTCCTCAAGGGGCACCAAGAAGAGGTG
CTGTTGGTGGGAGAAGCGGCTCTGGCCAGCGTCATTCAGGCCGTCGACGTGGCGCACGAGGCGGGCGTGGAAGAC
CAAGGCAAGCTCAAGGCGCTGCGAAACGTGCTCGTCAAGAAGGGCAGCTGGGCCGGGACCAAGGTGCAGATCAAG
CCCATGTTTCGCAAGCGGAGTGCCGATGAAGTCTCGGCGGCCGATATGGGCAAAAGGGCAGTCAGCACGCCCATT
AGAGAGCACGTCGAGGGCAAGAGCGCGCCTTGCAACCGCCGGCACGACTCGCTGTCGGGCGTCACCATGTCCAAG
TTCACGGCTGCCGAGGAGCAGCTGGTGCTGGACAAGCTGCAGCTCATTGTCAAGTGGGGGGGCGAGCCGACACAC
TCGGCACGCTACCAGTCGCAGGAGCTGGGCGAGAACATGCGCAACGACCTCAAGCTGCTCAACCGCGACATTCTC
GACGAGGTGCACGTCTATAGCAGCTCGGAGCGGCGCGTGACGGCGAGTGCGCAAATCTGGGCCGCGTCGTTTCTC
GGCCGCAAGGACATTGGCGAGGACTTCATCACGATCCGCAAGGACCTCTTGGACGACTCCAACGCGGCCAAGGAC
GAGATGGACAAGGTCAAGAAGAAGCTCAAGGGCCTGCTGCGCAAGGGAAACGAGCGCCCCGCCGAGTTTGCCTGG
CCCGACAACATGCCGGAGCCGTCCGAGGTGCAGACGAGGGTGGTGCAACTCATGAATTTCCACCGCCGCGTCATG
CAGTACAACTATGCAAAGCTCTACAATGGCTCTGCGCCCTCGCTGGGCTCCATTTCCAACGCCAGCGCCGAGAAG
CTGGCGGCAGACAACTCGACGGCGTCGCTGTCGTCGCTGTCCCACGCCAATGCCATCAACAGCATCCAGTCGCGC
TGGTGCAGCGGCGAGGACGCGGAGCTGTTTCGGGAGCGCTGGGAAAAGCTCTTTAGCGAGTTTTGCGATGGCGAA
AAGGTGGATCCTAGCAAGATCTCGGAGCTCTACGACACGATGAAGTTTGACGCCTTGCACAACCGCCAGTTCCTC
GAATGGGTCTTCTTGCCGCCCAAGATGATGCTGGACGAGGAATACATGGCGGCCAAGGAGGCTCGCAAATCAAGG
GACCATGACGAGAGCCGCGGGCCCGACGAGCAGCAGCGCCAGCACCCTTCGCCCGATGCATCTGACAAGTCTGAC
TCGTCGGGCCGCGGCGGCTCAGTCAAGAAGCTCTTCCACCGCCGCTCCTTTCTCAACGGCATCCGCCACCTCAAC
GAAGAGGGCCCGCCCGAGCAGTACTTTCGCCTCTTCAAGGGCGTCCACCAGCCCCCCACAAAGGCGGATGCGCGA
AACGATCCACTGCAGGAACTCTACCGCCTGGCCAAGGTGCTCTTTGACTTCATCTGCCCTCAGGAATACGGCATT
TCAGACACGGAGAAGCTCGAGATTGGCCTGCTGACGTCGCTGCCTCTGCTCAAGGAGATTGTCCAGGACCTGGAG
GAGATGCAGGCCTCCAACGACGCAAAGTCCTTCTTCTACTTTACCAAGGAGTCGCACATTTACACCCTGCTCAAC
TGCATCATTGAAGGCGGCATCGAGACCAAGATTAAGCGCAGCACCATTCCCGAGCTCGACTACCTGTCTCAGATT
TGCTTTGAGCTGTACGAGTCGGAGACGAAGCCCTCGGATGCGGGCGTCGAGGGCGACGAAACCACGTTTGCCTAT
AGCATCCGCATCACCATTAGCCCGGGCTGCCACGTCTTTGACCCTCTGCACGTCCAGCTGGACAGCCGCCACTGC
ATAGGCTGCGCTCCCCGGCGCAGCTTGACGCCACACATTGACTGGCTGCAAGTCATCAAGACGCTGCGCGCCAAA
TTTAATCAGTAAGTAGCCTGTCTGTCTGCCTCGTGTTGCCACCCACCCTTAGCGCTCCCAGTCGCCCCCCGAGAT
GCTGGGGAGCGCGAGCCGGCAAAAAGTGACAAGTGACACCCTGCCCTGTCTGCCGCGTCTCTTGTGCTGACAGCA
GTGCGCTGCTCAGGGTCAAGCTGCCAAAGACATTTCTAGCCGTCAACCTATCAGAGGCCTTTACCTTTGAGGAAC
AGGAACGCCTGGCCAACGACGACGGGCTCGAGATGAAGATGGCGCCGCCCAAGGATCTGCTGTCGAGCGCGTCTG
CTGCCCAAGCTGAGGACAGTGCTGCGCCTGGGCACCAGCCGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail