Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1251
Gene name
LocationContig_13:187106..191953
Strand+
Gene length (bp)4847
Transcript length (bp)4503
Coding sequence length (bp)4503
Protein length (aa) 1501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 4.7E-111 773 1393
PF18086 PPIP5K2_N Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain 4.8E-36 301 388
PF08443 RimK RimK-like ATP-grasp domain 1.7E-07 522 614

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 766 1453 5.0E-171
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 295 658 8.0E-143
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 299 651 2.0E-133
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 769 1175 9.0E-94
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 300 639 4.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 766 1453 5.0E-171
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 295 658 8.0E-143
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 299 651 2.0E-133
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 769 1175 9.0E-94
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 300 639 4.0E-88
sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 300 639 4.0E-88
sp|Q6ZQB6|VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus GN=Ppip5k2 PE=1 SV=3 300 639 8.0E-88
sp|Q5XHF8|VIP2_XENLA Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Xenopus laevis GN=ppip5k2 PE=2 SV=1 295 639 2.0E-87
sp|Q6PFW1|VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens GN=PPIP5K1 PE=1 SV=1 300 639 2.0E-86
sp|A7Z050|VIP1_BOVIN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Bos taurus GN=PPIP5K1 PE=2 SV=1 300 639 2.0E-86
sp|A2ARP1|VIP1_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Mus musculus GN=Ppip5k1 PE=1 SV=1 300 639 2.0E-85
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 300 639 2.0E-85
sp|P0C644|VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus GN=Ppip5k1 PE=1 SV=1 300 639 2.0E-85
sp|Q9VR59|VIP1_DROME Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Drosophila melanogaster GN=l(1)G0196 PE=1 SV=2 300 639 5.0E-84
sp|P91309|VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans GN=F46F11.1 PE=3 SV=3 292 638 4.0E-81
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 1266 1453 3.0E-55
sp|A7Z050|VIP1_BOVIN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Bos taurus GN=PPIP5K1 PE=2 SV=1 1268 1372 1.0E-13
sp|P0C644|VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus GN=Ppip5k1 PE=1 SV=1 1268 1372 5.0E-13
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 773 1158 6.0E-13
sp|A2ARP1|VIP1_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Mus musculus GN=Ppip5k1 PE=1 SV=1 1268 1372 1.0E-12
sp|Q6PFW1|VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens GN=PPIP5K1 PE=1 SV=1 1268 1372 2.0E-12
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 1268 1372 7.0E-12
sp|Q5XHF8|VIP2_XENLA Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Xenopus laevis GN=ppip5k2 PE=2 SV=1 1268 1396 2.0E-11
sp|Q6ZQB6|VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus GN=Ppip5k2 PE=1 SV=3 1268 1372 2.0E-11
sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 1268 1372 2.0E-11
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 1268 1372 2.0E-11
sp|Q9VR59|VIP1_DROME Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Drosophila melanogaster GN=l(1)G0196 PE=1 SV=2 1264 1372 7.0E-11
sp|P91309|VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans GN=F46F11.1 PE=3 SV=3 1266 1398 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1251
MEHSPSIPFSSPADPSFRRGHPLVGPCSLSSDASPAEPSLHLHRQLQQCQHGLSHSRSISSSSVASWQSRQSPAE
RFSAGPLLVAKSPSRSQHQPATSDACSEVLVFGEPQLSSSTDDTDTPRIRPGLSSSPDSTALTFLPEPALVSRPS
LPPRNHSRHLSVNSIYSLFSARRIMTSPPSTQGSDVGGAPRSVSSIVSTTAGGSVNSEAVVASPCSAQASQPPMG
GQQQMASREPLAQPSELIKRNQRGDGSLRSQPDRSRSRAKRRFSGSTAASSHSPSSERGPHHRDKEETKPATWGV
IGICALDVKARSKPSRNILNRLIAQREFDVVVFGDKVILDEEVENWPICDYLISFYSDGFPLEKAIAYVKARKPF
CVNDVPMQKILWDRRVCLRLLDKINVRTPKRLEVSRDGGPKMLTAEMAKHIKEVSGVSLTPVDANDGPQRPQVQL
VEEGDVLSVDGVSLRKPFVEKPTSGEDHNIMIYFPNSSGGGARKLFRKIGNKSSDYVPDLNVPRVLTEPDSSYIY
ESFMQVDNAEDVKAYTVGPQYCHAETRKSPVVDGIVRRNTHGKEVRYVTSLTPEEKDMASKISSAFGQRVCGFDL
LRASGKSYVIDVNGWSFVKDNDDYYEHCALILKDIFVKERLRRGGVSPPLPSPAASEVDPLARAALAIKEREQQA
SAAPVHKASPPDVEQQASHVAGRCSEVPTKSKSDGAIDCMGQSSEPSPLLPVPPPDLTASNAHSAASSVKTWSVV
PPGTHAPEQQSSPAPPPPKHSWKLKGMVTVIRHADRTPKQKYKFTFHTEPFIALLKGHQEEVLLVGEAALASVIQ
AVDVAHEAGVEDQGKLKALRNVLVKKGSWAGTKVQIKPMFRKRSADEVSAADMGKRAVSTPIREHVEGKSAPCNR
RHDSLSGVTMSKFTAAEEQLVLDKLQLIVKWGGEPTHSARYQSQELGENMRNDLKLLNRDILDEVHVYSSSERRV
TASAQIWAASFLGRKDIGEDFITIRKDLLDDSNAAKDEMDKVKKKLKGLLRKGNERPAEFAWPDNMPEPSEVQTR
VVQLMNFHRRVMQYNYAKLYNGSAPSLGSISNASAEKLAADNSTASLSSLSHANAINSIQSRWCSGEDAELFRER
WEKLFSEFCDGEKVDPSKISELYDTMKFDALHNRQFLEWVFLPPKMMLDEEYMAAKEARKSRDHDESRGPDEQQR
QHPSPDASDKSDSSGRGGSVKKLFHRRSFLNGIRHLNEEGPPEQYFRLFKGVHQPPTKADARNDPLQELYRLAKV
LFDFICPQEYGISDTEKLEIGLLTSLPLLKEIVQDLEEMQASNDAKSFFYFTKESHIYTLLNCIIEGGIETKIKR
STIPELDYLSQICFELYESETKPSDAGVEGDETTFAYSIRITISPGCHVFDPLHVQLDSRHCIGCAPRRSLTPHI
DWLQVIKTLRAKFNQVKLPKTFLAVNLSEAFTFEEQERLANDDGLEMKMAPPKDLLSSASAAQAEDSAAPGHQPA
*
Coding >OphauB2|1251
ATGGAGCACTCCCCTTCCATTCCTTTCTCGTCGCCCGCCGACCCCTCCTTCCGGCGCGGCCACCCGTTGGTTGGG
CCTTGCTCTCTCTCGTCCGACGCCTCGCCGGCTGAGCCGTCTCTTCACCTCCACCGCCAGCTGCAACAGTGCCAG
CATGGTCTGTCGCATTCTCGCAGCATATCCTCGTCTTCTGTTGCCAGTTGGCAGAGCCGTCAGAGCCCCGCTGAA
CGATTCTCTGCCGGCCCACTATTGGTGGCGAAATCGCCGTCGCGTAGCCAGCACCAACCGGCCACTTCAGACGCT
TGCAGTGAAGTCCTCGTCTTTGGCGAGCCGCAACTCTCCTCCTCCACCGACGACACGGACACGCCGAGAATCCGC
CCGGGCTTGAGTTCAAGTCCCGATTCGACAGCTTTGACTTTTCTACCCGAGCCTGCTTTGGTCTCGAGACCCTCT
CTCCCCCCTCGAAACCACTCGAGACATCTTTCCGTCAATTCCATTTATTCCTTGTTCTCTGCTCGCCGCATCATG
ACTTCGCCACCCTCGACCCAGGGCTCAGATGTCGGAGGCGCCCCCAGGTCTGTCTCGAGCATTGTTTCCACCACT
GCTGGCGGCTCTGTAAACTCTGAAGCTGTTGTTGCCTCTCCATGCAGCGCCCAGGCTAGCCAGCCCCCCATGGGA
GGACAGCAGCAAATGGCGTCTCGCGAACCCTTGGCCCAGCCATCAGAGCTTATAAAGCGAAATCAGCGTGGCGAT
GGCAGTCTACGCTCCCAGCCCGATCGCTCCCGCAGCCGAGCAAAGCGAAGATTCAGCGGTAGCACCGCCGCGAGC
AGCCACAGCCCGAGCAGCGAGCGTGGACCGCACCATCGCGACAAGGAAGAGACCAAACCAGCCACGTGGGGAGTT
ATCGGTATATGCGCTCTCGATGTCAAGGCCAGGAGCAAGCCGAGCAGAAACATCCTCAACCGCCTAATTGCCCAG
CGGGAATTCGACGTTGTGGTTTTTGGAGACAAGGTGATACTTGATGAAGAGGTTGAGAACTGGCCAATCTGCGAC
TACTTGATATCATTCTACTCGGACGGATTTCCTTTGGAAAAGGCAATTGCCTATGTCAAGGCGCGAAAGCCTTTC
TGCGTCAATGACGTGCCTATGCAGAAGATTCTGTGGGACCGGAGAGTCTGCCTCCGCCTCCTCGACAAGATCAAT
GTGCGGACGCCCAAACGACTCGAGGTCAGCCGTGACGGCGGACCCAAGATGCTGACAGCCGAAATGGCCAAGCAT
ATCAAGGAAGTGTCGGGAGTCAGCCTGACGCCTGTGGATGCAAATGATGGGCCACAACGGCCGCAAGTCCAGCTT
GTTGAAGAGGGCGATGTGCTGAGCGTGGATGGCGTGTCGCTGCGAAAGCCCTTTGTTGAAAAGCCGACGAGCGGC
GAAGACCACAACATTATGATATATTTTCCAAACAGCTCTGGTGGCGGCGCCAGGAAGCTTTTTCGAAAAATCGGC
AACAAAAGCTCCGACTATGTGCCCGACCTCAATGTGCCGCGAGTGCTGACGGAGCCTGACAGCAGCTACATTTAC
GAGAGCTTTATGCAAGTCGACAATGCAGAAGACGTCAAGGCGTACACGGTGGGGCCTCAGTACTGCCACGCAGAG
ACGCGCAAGTCGCCCGTTGTTGACGGCATTGTGCGCCGCAACACGCATGGCAAGGAAGTTCGCTATGTCACGTCG
CTGACGCCCGAGGAAAAGGACATGGCAAGCAAAATCTCGTCTGCCTTTGGGCAGAGGGTCTGTGGCTTTGATTTG
CTTCGGGCTTCGGGCAAGAGCTACGTAATTGATGTCAATGGATGGAGCTTCGTCAAGGACAATGACGACTACTAC
GAGCACTGCGCTCTGATTCTCAAGGACATTTTTGTCAAGGAGAGGCTGCGGCGCGGGGGCGTGAGTCCTCCCCTG
CCCTCGCCAGCAGCGTCCGAGGTAGATCCTCTGGCGCGCGCCGCCCTGGCCATCAAGGAGCGCGAGCAGCAAGCC
TCTGCGGCGCCTGTGCACAAGGCGAGTCCTCCAGACGTTGAGCAGCAGGCCAGCCATGTAGCTGGTCGCTGCAGC
GAAGTGCCGACCAAGTCCAAGAGCGATGGCGCCATTGACTGCATGGGACAAAGCTCGGAGCCAAGCCCCTTGCTG
CCGGTGCCGCCTCCGGACCTGACAGCATCCAATGCCCATTCAGCTGCCTCGTCTGTCAAGACGTGGTCGGTGGTG
CCCCCGGGCACTCATGCTCCCGAGCAACAAAGCAGCCCCGCTCCGCCGCCGCCCAAGCACTCGTGGAAGCTCAAG
GGCATGGTGACGGTGATACGCCACGCCGACCGCACGCCCAAGCAAAAGTACAAGTTCACCTTCCACACGGAGCCC
TTTATCGCCCTCCTCAAGGGGCACCAAGAAGAGGTGCTGTTGGTGGGAGAAGCGGCTCTGGCCAGCGTCATTCAG
GCCGTCGACGTGGCGCACGAGGCGGGCGTGGAAGACCAAGGCAAGCTCAAGGCGCTGCGAAACGTGCTCGTCAAG
AAGGGCAGCTGGGCCGGGACCAAGGTGCAGATCAAGCCCATGTTTCGCAAGCGGAGTGCCGATGAAGTCTCGGCG
GCCGATATGGGCAAAAGGGCAGTCAGCACGCCCATTAGAGAGCACGTCGAGGGCAAGAGCGCGCCTTGCAACCGC
CGGCACGACTCGCTGTCGGGCGTCACCATGTCCAAGTTCACGGCTGCCGAGGAGCAGCTGGTGCTGGACAAGCTG
CAGCTCATTGTCAAGTGGGGGGGCGAGCCGACACACTCGGCACGCTACCAGTCGCAGGAGCTGGGCGAGAACATG
CGCAACGACCTCAAGCTGCTCAACCGCGACATTCTCGACGAGGTGCACGTCTATAGCAGCTCGGAGCGGCGCGTG
ACGGCGAGTGCGCAAATCTGGGCCGCGTCGTTTCTCGGCCGCAAGGACATTGGCGAGGACTTCATCACGATCCGC
AAGGACCTCTTGGACGACTCCAACGCGGCCAAGGACGAGATGGACAAGGTCAAGAAGAAGCTCAAGGGCCTGCTG
CGCAAGGGAAACGAGCGCCCCGCCGAGTTTGCCTGGCCCGACAACATGCCGGAGCCGTCCGAGGTGCAGACGAGG
GTGGTGCAACTCATGAATTTCCACCGCCGCGTCATGCAGTACAACTATGCAAAGCTCTACAATGGCTCTGCGCCC
TCGCTGGGCTCCATTTCCAACGCCAGCGCCGAGAAGCTGGCGGCAGACAACTCGACGGCGTCGCTGTCGTCGCTG
TCCCACGCCAATGCCATCAACAGCATCCAGTCGCGCTGGTGCAGCGGCGAGGACGCGGAGCTGTTTCGGGAGCGC
TGGGAAAAGCTCTTTAGCGAGTTTTGCGATGGCGAAAAGGTGGATCCTAGCAAGATCTCGGAGCTCTACGACACG
ATGAAGTTTGACGCCTTGCACAACCGCCAGTTCCTCGAATGGGTCTTCTTGCCGCCCAAGATGATGCTGGACGAG
GAATACATGGCGGCCAAGGAGGCTCGCAAATCAAGGGACCATGACGAGAGCCGCGGGCCCGACGAGCAGCAGCGC
CAGCACCCTTCGCCCGATGCATCTGACAAGTCTGACTCGTCGGGCCGCGGCGGCTCAGTCAAGAAGCTCTTCCAC
CGCCGCTCCTTTCTCAACGGCATCCGCCACCTCAACGAAGAGGGCCCGCCCGAGCAGTACTTTCGCCTCTTCAAG
GGCGTCCACCAGCCCCCCACAAAGGCGGATGCGCGAAACGATCCACTGCAGGAACTCTACCGCCTGGCCAAGGTG
CTCTTTGACTTCATCTGCCCTCAGGAATACGGCATTTCAGACACGGAGAAGCTCGAGATTGGCCTGCTGACGTCG
CTGCCTCTGCTCAAGGAGATTGTCCAGGACCTGGAGGAGATGCAGGCCTCCAACGACGCAAAGTCCTTCTTCTAC
TTTACCAAGGAGTCGCACATTTACACCCTGCTCAACTGCATCATTGAAGGCGGCATCGAGACCAAGATTAAGCGC
AGCACCATTCCCGAGCTCGACTACCTGTCTCAGATTTGCTTTGAGCTGTACGAGTCGGAGACGAAGCCCTCGGAT
GCGGGCGTCGAGGGCGACGAAACCACGTTTGCCTATAGCATCCGCATCACCATTAGCCCGGGCTGCCACGTCTTT
GACCCTCTGCACGTCCAGCTGGACAGCCGCCACTGCATAGGCTGCGCTCCCCGGCGCAGCTTGACGCCACACATT
GACTGGCTGCAAGTCATCAAGACGCTGCGCGCCAAATTTAATCAGGTCAAGCTGCCAAAGACATTTCTAGCCGTC
AACCTATCAGAGGCCTTTACCTTTGAGGAACAGGAACGCCTGGCCAACGACGACGGGCTCGAGATGAAGATGGCG
CCGCCCAAGGATCTGCTGTCGAGCGCGTCTGCTGCCCAAGCTGAGGACAGTGCTGCGCCTGGGCACCAGCCGGCC
TGA
Transcript >OphauB2|1251
ATGGAGCACTCCCCTTCCATTCCTTTCTCGTCGCCCGCCGACCCCTCCTTCCGGCGCGGCCACCCGTTGGTTGGG
CCTTGCTCTCTCTCGTCCGACGCCTCGCCGGCTGAGCCGTCTCTTCACCTCCACCGCCAGCTGCAACAGTGCCAG
CATGGTCTGTCGCATTCTCGCAGCATATCCTCGTCTTCTGTTGCCAGTTGGCAGAGCCGTCAGAGCCCCGCTGAA
CGATTCTCTGCCGGCCCACTATTGGTGGCGAAATCGCCGTCGCGTAGCCAGCACCAACCGGCCACTTCAGACGCT
TGCAGTGAAGTCCTCGTCTTTGGCGAGCCGCAACTCTCCTCCTCCACCGACGACACGGACACGCCGAGAATCCGC
CCGGGCTTGAGTTCAAGTCCCGATTCGACAGCTTTGACTTTTCTACCCGAGCCTGCTTTGGTCTCGAGACCCTCT
CTCCCCCCTCGAAACCACTCGAGACATCTTTCCGTCAATTCCATTTATTCCTTGTTCTCTGCTCGCCGCATCATG
ACTTCGCCACCCTCGACCCAGGGCTCAGATGTCGGAGGCGCCCCCAGGTCTGTCTCGAGCATTGTTTCCACCACT
GCTGGCGGCTCTGTAAACTCTGAAGCTGTTGTTGCCTCTCCATGCAGCGCCCAGGCTAGCCAGCCCCCCATGGGA
GGACAGCAGCAAATGGCGTCTCGCGAACCCTTGGCCCAGCCATCAGAGCTTATAAAGCGAAATCAGCGTGGCGAT
GGCAGTCTACGCTCCCAGCCCGATCGCTCCCGCAGCCGAGCAAAGCGAAGATTCAGCGGTAGCACCGCCGCGAGC
AGCCACAGCCCGAGCAGCGAGCGTGGACCGCACCATCGCGACAAGGAAGAGACCAAACCAGCCACGTGGGGAGTT
ATCGGTATATGCGCTCTCGATGTCAAGGCCAGGAGCAAGCCGAGCAGAAACATCCTCAACCGCCTAATTGCCCAG
CGGGAATTCGACGTTGTGGTTTTTGGAGACAAGGTGATACTTGATGAAGAGGTTGAGAACTGGCCAATCTGCGAC
TACTTGATATCATTCTACTCGGACGGATTTCCTTTGGAAAAGGCAATTGCCTATGTCAAGGCGCGAAAGCCTTTC
TGCGTCAATGACGTGCCTATGCAGAAGATTCTGTGGGACCGGAGAGTCTGCCTCCGCCTCCTCGACAAGATCAAT
GTGCGGACGCCCAAACGACTCGAGGTCAGCCGTGACGGCGGACCCAAGATGCTGACAGCCGAAATGGCCAAGCAT
ATCAAGGAAGTGTCGGGAGTCAGCCTGACGCCTGTGGATGCAAATGATGGGCCACAACGGCCGCAAGTCCAGCTT
GTTGAAGAGGGCGATGTGCTGAGCGTGGATGGCGTGTCGCTGCGAAAGCCCTTTGTTGAAAAGCCGACGAGCGGC
GAAGACCACAACATTATGATATATTTTCCAAACAGCTCTGGTGGCGGCGCCAGGAAGCTTTTTCGAAAAATCGGC
AACAAAAGCTCCGACTATGTGCCCGACCTCAATGTGCCGCGAGTGCTGACGGAGCCTGACAGCAGCTACATTTAC
GAGAGCTTTATGCAAGTCGACAATGCAGAAGACGTCAAGGCGTACACGGTGGGGCCTCAGTACTGCCACGCAGAG
ACGCGCAAGTCGCCCGTTGTTGACGGCATTGTGCGCCGCAACACGCATGGCAAGGAAGTTCGCTATGTCACGTCG
CTGACGCCCGAGGAAAAGGACATGGCAAGCAAAATCTCGTCTGCCTTTGGGCAGAGGGTCTGTGGCTTTGATTTG
CTTCGGGCTTCGGGCAAGAGCTACGTAATTGATGTCAATGGATGGAGCTTCGTCAAGGACAATGACGACTACTAC
GAGCACTGCGCTCTGATTCTCAAGGACATTTTTGTCAAGGAGAGGCTGCGGCGCGGGGGCGTGAGTCCTCCCCTG
CCCTCGCCAGCAGCGTCCGAGGTAGATCCTCTGGCGCGCGCCGCCCTGGCCATCAAGGAGCGCGAGCAGCAAGCC
TCTGCGGCGCCTGTGCACAAGGCGAGTCCTCCAGACGTTGAGCAGCAGGCCAGCCATGTAGCTGGTCGCTGCAGC
GAAGTGCCGACCAAGTCCAAGAGCGATGGCGCCATTGACTGCATGGGACAAAGCTCGGAGCCAAGCCCCTTGCTG
CCGGTGCCGCCTCCGGACCTGACAGCATCCAATGCCCATTCAGCTGCCTCGTCTGTCAAGACGTGGTCGGTGGTG
CCCCCGGGCACTCATGCTCCCGAGCAACAAAGCAGCCCCGCTCCGCCGCCGCCCAAGCACTCGTGGAAGCTCAAG
GGCATGGTGACGGTGATACGCCACGCCGACCGCACGCCCAAGCAAAAGTACAAGTTCACCTTCCACACGGAGCCC
TTTATCGCCCTCCTCAAGGGGCACCAAGAAGAGGTGCTGTTGGTGGGAGAAGCGGCTCTGGCCAGCGTCATTCAG
GCCGTCGACGTGGCGCACGAGGCGGGCGTGGAAGACCAAGGCAAGCTCAAGGCGCTGCGAAACGTGCTCGTCAAG
AAGGGCAGCTGGGCCGGGACCAAGGTGCAGATCAAGCCCATGTTTCGCAAGCGGAGTGCCGATGAAGTCTCGGCG
GCCGATATGGGCAAAAGGGCAGTCAGCACGCCCATTAGAGAGCACGTCGAGGGCAAGAGCGCGCCTTGCAACCGC
CGGCACGACTCGCTGTCGGGCGTCACCATGTCCAAGTTCACGGCTGCCGAGGAGCAGCTGGTGCTGGACAAGCTG
CAGCTCATTGTCAAGTGGGGGGGCGAGCCGACACACTCGGCACGCTACCAGTCGCAGGAGCTGGGCGAGAACATG
CGCAACGACCTCAAGCTGCTCAACCGCGACATTCTCGACGAGGTGCACGTCTATAGCAGCTCGGAGCGGCGCGTG
ACGGCGAGTGCGCAAATCTGGGCCGCGTCGTTTCTCGGCCGCAAGGACATTGGCGAGGACTTCATCACGATCCGC
AAGGACCTCTTGGACGACTCCAACGCGGCCAAGGACGAGATGGACAAGGTCAAGAAGAAGCTCAAGGGCCTGCTG
CGCAAGGGAAACGAGCGCCCCGCCGAGTTTGCCTGGCCCGACAACATGCCGGAGCCGTCCGAGGTGCAGACGAGG
GTGGTGCAACTCATGAATTTCCACCGCCGCGTCATGCAGTACAACTATGCAAAGCTCTACAATGGCTCTGCGCCC
TCGCTGGGCTCCATTTCCAACGCCAGCGCCGAGAAGCTGGCGGCAGACAACTCGACGGCGTCGCTGTCGTCGCTG
TCCCACGCCAATGCCATCAACAGCATCCAGTCGCGCTGGTGCAGCGGCGAGGACGCGGAGCTGTTTCGGGAGCGC
TGGGAAAAGCTCTTTAGCGAGTTTTGCGATGGCGAAAAGGTGGATCCTAGCAAGATCTCGGAGCTCTACGACACG
ATGAAGTTTGACGCCTTGCACAACCGCCAGTTCCTCGAATGGGTCTTCTTGCCGCCCAAGATGATGCTGGACGAG
GAATACATGGCGGCCAAGGAGGCTCGCAAATCAAGGGACCATGACGAGAGCCGCGGGCCCGACGAGCAGCAGCGC
CAGCACCCTTCGCCCGATGCATCTGACAAGTCTGACTCGTCGGGCCGCGGCGGCTCAGTCAAGAAGCTCTTCCAC
CGCCGCTCCTTTCTCAACGGCATCCGCCACCTCAACGAAGAGGGCCCGCCCGAGCAGTACTTTCGCCTCTTCAAG
GGCGTCCACCAGCCCCCCACAAAGGCGGATGCGCGAAACGATCCACTGCAGGAACTCTACCGCCTGGCCAAGGTG
CTCTTTGACTTCATCTGCCCTCAGGAATACGGCATTTCAGACACGGAGAAGCTCGAGATTGGCCTGCTGACGTCG
CTGCCTCTGCTCAAGGAGATTGTCCAGGACCTGGAGGAGATGCAGGCCTCCAACGACGCAAAGTCCTTCTTCTAC
TTTACCAAGGAGTCGCACATTTACACCCTGCTCAACTGCATCATTGAAGGCGGCATCGAGACCAAGATTAAGCGC
AGCACCATTCCCGAGCTCGACTACCTGTCTCAGATTTGCTTTGAGCTGTACGAGTCGGAGACGAAGCCCTCGGAT
GCGGGCGTCGAGGGCGACGAAACCACGTTTGCCTATAGCATCCGCATCACCATTAGCCCGGGCTGCCACGTCTTT
GACCCTCTGCACGTCCAGCTGGACAGCCGCCACTGCATAGGCTGCGCTCCCCGGCGCAGCTTGACGCCACACATT
GACTGGCTGCAAGTCATCAAGACGCTGCGCGCCAAATTTAATCAGGTCAAGCTGCCAAAGACATTTCTAGCCGTC
AACCTATCAGAGGCCTTTACCTTTGAGGAACAGGAACGCCTGGCCAACGACGACGGGCTCGAGATGAAGATGGCG
CCGCCCAAGGATCTGCTGTCGAGCGCGTCTGCTGCCCAAGCTGAGGACAGTGCTGCGCCTGGGCACCAGCCGGCC
TGA
Gene >OphauB2|1251
ATGGAGCACTCCCCTTCCATTCCTTTCTCGTCGCCCGCCGACCCCTCCTTCCGGCGCGGCCACCCGTTGGTTGGG
CCTTGCTCTCTCTCGTCCGACGCCTCGCCGGCTGAGCCGTCTCTTCACCTCCACCGCCAGCTGCAACAGTGCCAG
CATGGTCTGTCGCATTCTCGCAGCATATCCTCGTCTTCTGTTGCCAGTTGGCAGAGCCGTCAGAGCCCCGCTGAA
CGATTCTCTGCCGGCCCACTATTGGTGGCGAAATCGCCGTCGCGTAGCCAGCACCAACCGGCCACTTCAGACGCT
TGCAGTGAAGTCCTCGTCTTTGGCGAGCCGCAACTCTCCTCCTCCACCGACGACACGGACACGCCGAGAATCCGC
CCGGGCTTGAGTTCAAGTCCCGATTCGACAGCTTTGACTTTTCTACCCGAGCCTGCTTTGGTCTCGAGACCCTCT
CTCCCCCCTCGAAACCACTCGAGACATCTTTCCGTCAATTCCATTTATTCCTTGTTCTCTGCTCGCCGCATCATG
ACTTCGCCACCCTCGACCCAGGGCTCAGATGTCGGAGGCGCCCCCAGGTCTGTCTCGAGCATTGTTTCCACCACT
GCTGGCGGCTCTGTAAACTCTGAAGCTGTTGTTGCCTCTCCATGCAGCGCCCAGGCTAGCCAGCCCCCCATGGGA
GGACAGCAGCAAATGGCGTCTCGCGAACCCTTGGCCCAGCCATCAGAGCTTATAAAGCGAAATCAGCGTGGCGAT
GGCAGTCTACGCTCCCAGCCCGATCGCTCCCGCAGCCGAGCAAAGCGAAGATTCAGCGGTAGCACCGCCGCGAGC
AGCCACAGCCCGAGCAGCGAGCGTGGACCGCACCATCGCGACAAGGAAGAGAGTAAGCCAAGATGAAGAGGAGCA
ATTGGGCCGTGTATGAGCAAGCATTGACGCGCCTAGTAGCCAAACCAGCCACGTGGGGAGTTATCGGTATATGCG
CTCTCGATGTCAAGGCCAGGAGCAAGCCGAGCAGAAACATCCTCAACCGCCTAATTGCCCAGCGGGAATTCGACG
TTGTGGTTTTTGGAGACAAGGTGATACTTGATGAAGGTATGTCATGGCAATCGTCTTGTTAGACGGTCAATGGGC
GGCAGCTGACGGCGAGTCGTCAGAGGTTGAGAACTGGCCAATCTGGTAAGTCGTCGGTGGTGTCTCAGTCAAAAA
AGAGCTCATTGCAAGGTGACTAACGTGGATTTCAGCGACTACTTGATATCATTCTACTCGGACGGATTTCCTTTG
GAAAAGGCAATTGCCTATGTCAAGGCGCGAAAGCCTTTCTGCGTCAATGACGTGCCTATGCAGAAGATTCTGTGG
GACCGGAGAGTCTGCCTCCGCCTCCTCGACAAGATCAATGTGCGGACGCCCAAACGACTCGAGGTCAGCCGTGAC
GGCGGACCCAAGATGCTGACAGCCGAAATGGCCAAGCATATCAAGGAAGTGTCGGGAGTCAGCCTGACGCCTGTG
GATGCAAATGATGGGCCACAACGGCCGCAAGTCCAGCTTGTTGAAGAGGGCGATGTGCTGAGCGTGGATGGCGTG
TCGCTGCGAAAGCCCTTTGTTGAAAAGCCGACGAGCGGCGAAGACCACAACATTATGATATATTTTCCAAACAGC
TCTGGTGGCGGCGCCAGGAAGCTTTTTCGAAAAATCGGCAACAAAAGCTCCGACTATGTGCCCGACCTCAATGTG
CCGCGAGTGCTGACGGAGCCTGACAGCAGCTACATTTACGAGAGCTTTATGCAAGTCGACAATGCAGAAGACGTC
AAGGCGTACACGGTGGGGCCTCAGTACTGCCACGCAGAGACGCGCAAGTCGCCCGTTGTTGACGGCATTGTGCGC
CGCAACACGCATGGCAAGGAAGTTCGCTATGTCACGTCGCTGACGCCCGAGGAAAAGGACATGGCAAGCAAAATC
TCGTCTGCCTTTGGGCAGAGGGTCTGTGGCTTTGATTTGCTTCGGGCTTCGGGCAAGAGCTACGTAATTGATGTC
AATGGATGGAGCTTCGTCAAGGACAATGACGACTACTACGAGCACTGCGCTCTGATTCTCAAGGACATTTTTGTC
AAGGAGAGGCTGCGGCGCGGGGGCGTGAGTCCTCCCCTGCCCTCGCCAGCAGCGTCCGAGGTAGATCCTCTGGCG
CGCGCCGCCCTGGCCATCAAGGAGCGCGAGCAGCAAGCCTCTGCGGCGCCTGTGCACAAGGCGAGTCCTCCAGAC
GTTGAGCAGCAGGCCAGCCATGTAGCTGGTCGCTGCAGCGAAGTGCCGACCAAGTCCAAGAGCGATGGCGCCATT
GACTGCATGGGACAAAGCTCGGAGCCAAGCCCCTTGCTGCCGGTGCCGCCTCCGGACCTGACAGCATCCAATGCC
CATTCAGCTGCCTCGTCTGTCAAGACGTGGTCGGTGGTGCCCCCGGGCACTCATGCTCCCGAGCAACAAAGCAGC
CCCGCTCCGCCGCCGCCCAAGCACTCGTGGAAGCTCAAGGGCATGGTGACGGTGATACGCCACGCCGACCGCACG
CCCAAGCAAAAGTACAAGTTCACCTTCCACACGGAGCCCTTTATCGCCCTCCTCAAGGGGCACCAAGAAGAGGTG
CTGTTGGTGGGAGAAGCGGCTCTGGCCAGCGTCATTCAGGCCGTCGACGTGGCGCACGAGGCGGGCGTGGAAGAC
CAAGGCAAGCTCAAGGCGCTGCGAAACGTGCTCGTCAAGAAGGGCAGCTGGGCCGGGACCAAGGTGCAGATCAAG
CCCATGTTTCGCAAGCGGAGTGCCGATGAAGTCTCGGCGGCCGATATGGGCAAAAGGGCAGTCAGCACGCCCATT
AGAGAGCACGTCGAGGGCAAGAGCGCGCCTTGCAACCGCCGGCACGACTCGCTGTCGGGCGTCACCATGTCCAAG
TTCACGGCTGCCGAGGAGCAGCTGGTGCTGGACAAGCTGCAGCTCATTGTCAAGTGGGGGGGCGAGCCGACACAC
TCGGCACGCTACCAGTCGCAGGAGCTGGGCGAGAACATGCGCAACGACCTCAAGCTGCTCAACCGCGACATTCTC
GACGAGGTGCACGTCTATAGCAGCTCGGAGCGGCGCGTGACGGCGAGTGCGCAAATCTGGGCCGCGTCGTTTCTC
GGCCGCAAGGACATTGGCGAGGACTTCATCACGATCCGCAAGGACCTCTTGGACGACTCCAACGCGGCCAAGGAC
GAGATGGACAAGGTCAAGAAGAAGCTCAAGGGCCTGCTGCGCAAGGGAAACGAGCGCCCCGCCGAGTTTGCCTGG
CCCGACAACATGCCGGAGCCGTCCGAGGTGCAGACGAGGGTGGTGCAACTCATGAATTTCCACCGCCGCGTCATG
CAGTACAACTATGCAAAGCTCTACAATGGCTCTGCGCCCTCGCTGGGCTCCATTTCCAACGCCAGCGCCGAGAAG
CTGGCGGCAGACAACTCGACGGCGTCGCTGTCGTCGCTGTCCCACGCCAATGCCATCAACAGCATCCAGTCGCGC
TGGTGCAGCGGCGAGGACGCGGAGCTGTTTCGGGAGCGCTGGGAAAAGCTCTTTAGCGAGTTTTGCGATGGCGAA
AAGGTGGATCCTAGCAAGATCTCGGAGCTCTACGACACGATGAAGTTTGACGCCTTGCACAACCGCCAGTTCCTC
GAATGGGTCTTCTTGCCGCCCAAGATGATGCTGGACGAGGAATACATGGCGGCCAAGGAGGCTCGCAAATCAAGG
GACCATGACGAGAGCCGCGGGCCCGACGAGCAGCAGCGCCAGCACCCTTCGCCCGATGCATCTGACAAGTCTGAC
TCGTCGGGCCGCGGCGGCTCAGTCAAGAAGCTCTTCCACCGCCGCTCCTTTCTCAACGGCATCCGCCACCTCAAC
GAAGAGGGCCCGCCCGAGCAGTACTTTCGCCTCTTCAAGGGCGTCCACCAGCCCCCCACAAAGGCGGATGCGCGA
AACGATCCACTGCAGGAACTCTACCGCCTGGCCAAGGTGCTCTTTGACTTCATCTGCCCTCAGGAATACGGCATT
TCAGACACGGAGAAGCTCGAGATTGGCCTGCTGACGTCGCTGCCTCTGCTCAAGGAGATTGTCCAGGACCTGGAG
GAGATGCAGGCCTCCAACGACGCAAAGTCCTTCTTCTACTTTACCAAGGAGTCGCACATTTACACCCTGCTCAAC
TGCATCATTGAAGGCGGCATCGAGACCAAGATTAAGCGCAGCACCATTCCCGAGCTCGACTACCTGTCTCAGATT
TGCTTTGAGCTGTACGAGTCGGAGACGAAGCCCTCGGATGCGGGCGTCGAGGGCGACGAAACCACGTTTGCCTAT
AGCATCCGCATCACCATTAGCCCGGGCTGCCACGTCTTTGACCCTCTGCACGTCCAGCTGGACAGCCGCCACTGC
ATAGGCTGCGCTCCCCGGCGCAGCTTGACGCCACACATTGACTGGCTGCAAGTCATCAAGACGCTGCGCGCCAAA
TTTAATCAGTAAGTAGCCTGTCTGTCTGCCTCGTGTTGCCACCCACCCTTAGCGCTCCCAGTCGCCCCCCGAGAT
GCTGGGGAGCGCGAGCCGGCAAAAAGTGACAAGTGACACCCTGCCCTGTCTGCCGCGTCTCTTGTGCTGACAGCA
GTGCGCTGCTCAGGGTCAAGCTGCCAAAGACATTTCTAGCCGTCAACCTATCAGAGGCCTTTACCTTTGAGGAAC
AGGAACGCCTGGCCAACGACGACGGGCTCGAGATGAAGATGGCGCCGCCCAAGGATCTGCTGTCGAGCGCGTCTG
CTGCCCAAGCTGAGGACAGTGCTGCGCCTGGGCACCAGCCGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail