Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1250
Gene name
LocationContig_13:183303..186559
Strand-
Gene length (bp)3256
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04192 Utp21 Utp21 specific WD40 associated putative domain 2.7E-76 834 1041
PF00400 WD40 WD domain, G-beta repeat 2.7E-01 376 417
PF00400 WD40 WD domain, G-beta repeat 1.9E-05 704 736
PF02239 Cytochrom_D1 Cytochrome D1 heme domain 1.2E-07 686 794

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14053|UTP21_SCHPO U3 small nucleolar RNA-associated protein 21 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.07 PE=3 SV=1 9 1042 0.0E+00
sp|Q06078|UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP21 PE=1 SV=1 29 1040 8.0E-164
sp|Q8NI36|WDR36_HUMAN WD repeat-containing protein 36 OS=Homo sapiens GN=WDR36 PE=1 SV=1 29 1042 2.0E-107
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 540 740 1.0E-12
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 540 740 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14053|UTP21_SCHPO U3 small nucleolar RNA-associated protein 21 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.07 PE=3 SV=1 9 1042 0.0E+00
sp|Q06078|UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP21 PE=1 SV=1 29 1040 8.0E-164
sp|Q8NI36|WDR36_HUMAN WD repeat-containing protein 36 OS=Homo sapiens GN=WDR36 PE=1 SV=1 29 1042 2.0E-107
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 540 740 1.0E-12
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 540 740 1.0E-12
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 540 740 1.0E-12
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 540 740 1.0E-12
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 540 740 1.0E-12
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 540 747 1.0E-12
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 540 740 1.0E-12
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 540 740 6.0E-12
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 613 770 4.0E-10
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 540 766 4.0E-10
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 613 770 8.0E-10
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 613 770 9.0E-10
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 613 770 9.0E-10
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 613 770 9.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 540 777 1.0E-09
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 613 770 1.0E-09
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 540 740 4.0E-09
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 540 766 8.0E-09
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 540 766 8.0E-09
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 540 766 8.0E-09
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 540 766 8.0E-09
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 540 766 8.0E-09
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 540 766 8.0E-09
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 540 766 8.0E-09
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 180 432 1.0E-08
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 540 766 1.0E-08
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 180 432 1.0E-08
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 180 432 1.0E-08
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 180 432 1.0E-08
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 180 432 2.0E-08
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 540 766 2.0E-08
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 635 782 2.0E-08
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 481 757 2.0E-08
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 578 739 3.0E-08
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 622 767 6.0E-08
sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 622 777 8.0E-08
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 180 422 9.0E-08
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 622 777 9.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 622 770 1.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 613 770 2.0E-07
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 622 764 2.0E-07
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 197 422 2.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 622 777 2.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 197 422 2.0E-07
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 195 432 3.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 545 768 3.0E-07
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 622 778 4.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 622 777 4.0E-07
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 593 747 4.0E-07
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 547 746 6.0E-07
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 519 747 7.0E-07
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 622 778 8.0E-07
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 540 796 9.0E-07
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 540 796 9.0E-07
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 519 747 9.0E-07
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 622 767 1.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 540 770 1.0E-06
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 622 777 1.0E-06
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 540 747 1.0E-06
sp|P49026|GBLP_TOBAC Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 539 749 1.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 622 777 1.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 622 777 1.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 622 777 1.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 622 777 1.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 622 777 1.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 622 777 1.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 622 777 1.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 622 777 2.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 196 432 2.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 572 739 2.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 622 777 2.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 622 777 2.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 622 777 2.0E-06
sp|P93340|GBLP_NICPL Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 539 749 2.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 622 778 2.0E-06
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 519 747 3.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 622 777 3.0E-06
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 195 432 3.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 613 770 3.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 613 770 3.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 196 432 3.0E-06
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 519 747 3.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 197 422 4.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 595 759 4.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 200 760 4.0E-06
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 602 750 4.0E-06
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 512 747 4.0E-06
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 622 780 5.0E-06
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 620 808 5.0E-06
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 622 777 6.0E-06
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 616 778 7.0E-06
sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 507 774 8.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 622 777 8.0E-06
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 540 749 8.0E-06
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 603 736 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:0005515 protein binding Yes
GO:0006364 rRNA processing Yes
GO:0034470 ncRNA processing No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0030684 preribosome No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1250
MPHSSLDSPLAKRQKLSGITPSANSAVNSSRIFAPFRTVGLVSPTSVPFTLVPLGKTSYQITTSVGRALQTYDLR
RGLNLVFVTRPQTPFDITASHAWKEKLLAAWGGSRAGEAQGLWIYQRGHKIYELAPPSDLSEPITQILAFGTWIV
AAASTRIEIFKFTTFEHYTTIHTMTSANQGHRITGGITNMPTYLNKILVGRNDGWVEIWNISTGKLIYTILPPSP
DSGFVTCMEPAPALSLVAIAYSTGLLVVSNILTDQSIIQVDAGSEEAPVNSISFRTDGIGAGQDGRKDGVMATTT
SATGDVTFWDLNRGGRVMGVLRSAHNPPSRDGSNVGGGISKATFLAGQPIIITSGYDNSLKSWIFDKTPFSPVPR
ILHTRSGHAGAVNCLHFLPTDFDGAEAGNKWILSGGRDRSLWGWSLRRDGQSTELSQGNVRKKAKKVGILAANAL
AHGPTTTLEDLKAPEITCIASCLNRDGGIGAMPGKQPIWQKDQKSTKAPDAEVSSMTGWESVVTAHKNDKYARTW
FWGRKRAGRWALPSGDGTHVSTVAMSPCGSFAVVGSEGGSVIMYNLQSGSVRHRFPSRLTPSQARQVRQLQLKQA
DDVSLLQSETGTGKFPPGTGKHTKAVTGIVVDSLNKHLVTCALDGKIKFWHFLTGTLLEQLDWSPMTSPILCRYQ
ASSSLMAFACDDMSVRIVDMDTKKTIRELWGPRDTINDLCFSNDGRWIMAASRDAIIRVWDLPTSHLIDAIRLER
PCTAISMSNTGEYLAATIENEPGVAIWTNKALFKHVSTRQISEKEIASLSLPSLSGEGNQGLLESAFEANEQDAD
DAVVAPSIDQLSSDLMTLSLVPKSRWQTLLHLDLVRERNKPKEPPKAPDKAPFFLPSVSASASMAKAQHTAQNAD
DEAKSRITKLDKSRLEELFSSKLRLAASTNNYDDFIQHLKSLSPSSADIELRSLSLGAGGQDDTNDLFHFIRALT
AQLKARKDYELTQAWMTVFLRLHSDIIMASDALMKALGEWKVQQELECERLNGLVGYCSGVVGFLKSPRT*
Coding >OphauB2|1250
ATGCCGCATTCGAGCCTTGACTCGCCGCTGGCCAAGCGCCAGAAGCTGTCGGGCATCACTCCGTCTGCAAACTCG
GCAGTCAATTCGTCGCGCATCTTTGCTCCTTTTCGGACTGTTGGGCTCGTCTCCCCCACGAGCGTCCCCTTCACA
TTGGTTCCTCTGGGAAAAACCAGCTATCAAATCACCACTTCGGTTGGTCGAGCGCTTCAGACATACGACTTGCGC
CGAGGCTTGAATCTCGTCTTCGTCACGCGCCCCCAGACGCCTTTTGACATCACAGCTTCCCATGCATGGAAGGAA
AAGCTACTTGCCGCATGGGGCGGCTCTCGGGCTGGCGAAGCCCAAGGCCTCTGGATCTATCAACGAGGCCACAAG
ATTTATGAACTTGCCCCGCCCTCAGATCTCTCGGAGCCCATTACTCAAATTCTCGCTTTCGGCACTTGGATCGTT
GCTGCTGCTTCTACGAGAATCGAGATTTTCAAATTTACAACCTTTGAACACTACACCACCATACACACCATGACA
TCAGCCAACCAAGGCCATCGCATTACCGGCGGCATCACCAATATGCCAACATATCTGAACAAGATTCTCGTGGGC
CGCAACGACGGCTGGGTTGAGATTTGGAACATTAGTACTGGCAAGCTCATCTACACCATTCTCCCCCCTTCCCCG
GACTCTGGCTTCGTCACGTGTATGGAGCCGGCTCCTGCTCTCTCTCTTGTGGCAATAGCTTACTCGACTGGACTG
CTGGTGGTGAGCAACATTTTGACCGATCAGTCCATCATACAAGTCGACGCAGGAAGCGAGGAGGCACCTGTCAAC
AGTATATCTTTTAGGACTGATGGCATAGGTGCTGGTCAGGACGGCAGGAAGGACGGCGTAATGGCTACTACGACG
TCGGCCACTGGAGACGTGACGTTTTGGGATTTGAATCGAGGCGGCCGTGTCATGGGAGTCCTGCGCAGTGCCCAC
AATCCTCCAAGTAGAGACGGCTCCAATGTTGGAGGAGGAATAAGCAAAGCTACCTTTTTGGCGGGCCAGCCAATC
ATCATCACCAGTGGATACGACAACTCGCTCAAATCGTGGATCTTTGACAAGACGCCCTTCTCGCCAGTGCCTAGG
ATTCTGCATACACGCAGTGGTCATGCTGGGGCTGTGAATTGCCTCCACTTTCTCCCCACAGATTTCGATGGTGCT
GAAGCGGGTAATAAATGGATTCTTAGCGGAGGCCGGGACAGGAGCCTTTGGGGCTGGAGTCTTCGTCGTGATGGT
CAAAGCACGGAGCTCAGCCAGGGAAATGTTCGCAAAAAGGCCAAAAAAGTTGGCATTCTGGCTGCTAATGCTCTA
GCTCACGGTCCTACAACAACGCTAGAAGACCTCAAGGCCCCAGAAATTACTTGCATTGCCTCATGCCTGAACCGA
GATGGTGGTATTGGCGCCATGCCCGGAAAACAGCCAATATGGCAAAAAGACCAAAAGAGCACAAAGGCCCCCGAC
GCAGAAGTCAGTAGCATGACGGGATGGGAAAGCGTTGTTACAGCACACAAAAACGACAAGTATGCTCGCACCTGG
TTCTGGGGCAGGAAGCGGGCAGGACGATGGGCCCTTCCAAGTGGCGACGGCACTCATGTGTCAACCGTTGCTATG
AGTCCCTGCGGATCCTTTGCCGTTGTTGGCTCCGAGGGGGGAAGCGTCATCATGTACAACCTCCAATCTGGCTCG
GTCCGACATCGCTTCCCGTCACGGTTAACGCCCTCGCAAGCACGCCAGGTTCGACAACTACAGCTAAAGCAGGCA
GATGATGTTAGTCTACTACAGTCCGAGACGGGCACTGGCAAATTCCCTCCCGGCACTGGCAAACACACCAAAGCT
GTGACGGGCATAGTTGTCGACTCGTTGAATAAGCATCTTGTTACATGTGCGCTCGACGGCAAAATCAAGTTTTGG
CACTTTTTGACGGGCACCTTGCTGGAGCAGCTGGATTGGTCACCCATGACAAGTCCGATCCTTTGCAGATATCAG
GCCTCGAGCAGCTTGATGGCCTTCGCTTGCGACGACATGTCGGTTCGCATTGTCGACATGGACACCAAGAAGACA
ATTCGAGAGCTCTGGGGTCCGCGTGACACCATCAACGATCTTTGCTTTTCAAACGATGGGCGTTGGATCATGGCT
GCTTCGCGAGACGCAATCATTCGAGTCTGGGATCTGCCAACAAGCCACCTAATTGACGCAATTCGATTGGAAAGG
CCCTGTACCGCCATCTCCATGTCTAACACTGGTGAATATTTGGCTGCGACTATAGAAAACGAGCCAGGCGTAGCC
ATTTGGACGAATAAGGCGCTCTTTAAACATGTGTCTACGCGACAGATATCAGAAAAGGAGATTGCTTCGCTTTCG
CTCCCCTCTCTCTCGGGAGAAGGTAATCAAGGTCTTTTGGAGAGCGCCTTTGAAGCTAATGAGCAAGACGCGGAC
GATGCTGTTGTGGCACCAAGCATCGACCAGCTCAGCTCGGATCTGATGACCCTGAGTCTGGTTCCTAAAAGCCGA
TGGCAAACATTGTTGCATCTTGACCTTGTCCGAGAACGTAACAAGCCCAAGGAGCCGCCCAAGGCACCTGACAAG
GCTCCATTTTTCCTCCCCTCTGTTTCTGCTTCGGCAAGCATGGCTAAAGCGCAGCATACGGCTCAGAATGCCGAT
GACGAGGCCAAGTCACGTATCACAAAGTTGGACAAGAGTCGATTGGAGGAACTATTCTCTTCCAAACTGAGATTG
GCTGCGTCTACCAACAACTATGATGATTTTATCCAACATCTCAAGTCCCTATCGCCCTCTAGTGCCGATATCGAA
TTGCGTTCTCTATCGTTGGGTGCTGGCGGCCAAGATGATACAAATGATCTTTTCCACTTTATCCGAGCCTTGACG
GCGCAGCTCAAAGCTAGGAAGGATTATGAGTTGACACAAGCATGGATGACTGTATTTCTTCGTCTGCATTCTGAC
ATTATCATGGCAAGCGACGCCCTCATGAAGGCACTGGGCGAATGGAAGGTGCAGCAGGAACTCGAGTGCGAGCGG
TTGAATGGTCTGGTAGGCTACTGCAGCGGCGTGGTAGGCTTTCTTAAAAGTCCGCGGACATGA
Transcript >OphauB2|1250
ATGCCGCATTCGAGCCTTGACTCGCCGCTGGCCAAGCGCCAGAAGCTGTCGGGCATCACTCCGTCTGCAAACTCG
GCAGTCAATTCGTCGCGCATCTTTGCTCCTTTTCGGACTGTTGGGCTCGTCTCCCCCACGAGCGTCCCCTTCACA
TTGGTTCCTCTGGGAAAAACCAGCTATCAAATCACCACTTCGGTTGGTCGAGCGCTTCAGACATACGACTTGCGC
CGAGGCTTGAATCTCGTCTTCGTCACGCGCCCCCAGACGCCTTTTGACATCACAGCTTCCCATGCATGGAAGGAA
AAGCTACTTGCCGCATGGGGCGGCTCTCGGGCTGGCGAAGCCCAAGGCCTCTGGATCTATCAACGAGGCCACAAG
ATTTATGAACTTGCCCCGCCCTCAGATCTCTCGGAGCCCATTACTCAAATTCTCGCTTTCGGCACTTGGATCGTT
GCTGCTGCTTCTACGAGAATCGAGATTTTCAAATTTACAACCTTTGAACACTACACCACCATACACACCATGACA
TCAGCCAACCAAGGCCATCGCATTACCGGCGGCATCACCAATATGCCAACATATCTGAACAAGATTCTCGTGGGC
CGCAACGACGGCTGGGTTGAGATTTGGAACATTAGTACTGGCAAGCTCATCTACACCATTCTCCCCCCTTCCCCG
GACTCTGGCTTCGTCACGTGTATGGAGCCGGCTCCTGCTCTCTCTCTTGTGGCAATAGCTTACTCGACTGGACTG
CTGGTGGTGAGCAACATTTTGACCGATCAGTCCATCATACAAGTCGACGCAGGAAGCGAGGAGGCACCTGTCAAC
AGTATATCTTTTAGGACTGATGGCATAGGTGCTGGTCAGGACGGCAGGAAGGACGGCGTAATGGCTACTACGACG
TCGGCCACTGGAGACGTGACGTTTTGGGATTTGAATCGAGGCGGCCGTGTCATGGGAGTCCTGCGCAGTGCCCAC
AATCCTCCAAGTAGAGACGGCTCCAATGTTGGAGGAGGAATAAGCAAAGCTACCTTTTTGGCGGGCCAGCCAATC
ATCATCACCAGTGGATACGACAACTCGCTCAAATCGTGGATCTTTGACAAGACGCCCTTCTCGCCAGTGCCTAGG
ATTCTGCATACACGCAGTGGTCATGCTGGGGCTGTGAATTGCCTCCACTTTCTCCCCACAGATTTCGATGGTGCT
GAAGCGGGTAATAAATGGATTCTTAGCGGAGGCCGGGACAGGAGCCTTTGGGGCTGGAGTCTTCGTCGTGATGGT
CAAAGCACGGAGCTCAGCCAGGGAAATGTTCGCAAAAAGGCCAAAAAAGTTGGCATTCTGGCTGCTAATGCTCTA
GCTCACGGTCCTACAACAACGCTAGAAGACCTCAAGGCCCCAGAAATTACTTGCATTGCCTCATGCCTGAACCGA
GATGGTGGTATTGGCGCCATGCCCGGAAAACAGCCAATATGGCAAAAAGACCAAAAGAGCACAAAGGCCCCCGAC
GCAGAAGTCAGTAGCATGACGGGATGGGAAAGCGTTGTTACAGCACACAAAAACGACAAGTATGCTCGCACCTGG
TTCTGGGGCAGGAAGCGGGCAGGACGATGGGCCCTTCCAAGTGGCGACGGCACTCATGTGTCAACCGTTGCTATG
AGTCCCTGCGGATCCTTTGCCGTTGTTGGCTCCGAGGGGGGAAGCGTCATCATGTACAACCTCCAATCTGGCTCG
GTCCGACATCGCTTCCCGTCACGGTTAACGCCCTCGCAAGCACGCCAGGTTCGACAACTACAGCTAAAGCAGGCA
GATGATGTTAGTCTACTACAGTCCGAGACGGGCACTGGCAAATTCCCTCCCGGCACTGGCAAACACACCAAAGCT
GTGACGGGCATAGTTGTCGACTCGTTGAATAAGCATCTTGTTACATGTGCGCTCGACGGCAAAATCAAGTTTTGG
CACTTTTTGACGGGCACCTTGCTGGAGCAGCTGGATTGGTCACCCATGACAAGTCCGATCCTTTGCAGATATCAG
GCCTCGAGCAGCTTGATGGCCTTCGCTTGCGACGACATGTCGGTTCGCATTGTCGACATGGACACCAAGAAGACA
ATTCGAGAGCTCTGGGGTCCGCGTGACACCATCAACGATCTTTGCTTTTCAAACGATGGGCGTTGGATCATGGCT
GCTTCGCGAGACGCAATCATTCGAGTCTGGGATCTGCCAACAAGCCACCTAATTGACGCAATTCGATTGGAAAGG
CCCTGTACCGCCATCTCCATGTCTAACACTGGTGAATATTTGGCTGCGACTATAGAAAACGAGCCAGGCGTAGCC
ATTTGGACGAATAAGGCGCTCTTTAAACATGTGTCTACGCGACAGATATCAGAAAAGGAGATTGCTTCGCTTTCG
CTCCCCTCTCTCTCGGGAGAAGGTAATCAAGGTCTTTTGGAGAGCGCCTTTGAAGCTAATGAGCAAGACGCGGAC
GATGCTGTTGTGGCACCAAGCATCGACCAGCTCAGCTCGGATCTGATGACCCTGAGTCTGGTTCCTAAAAGCCGA
TGGCAAACATTGTTGCATCTTGACCTTGTCCGAGAACGTAACAAGCCCAAGGAGCCGCCCAAGGCACCTGACAAG
GCTCCATTTTTCCTCCCCTCTGTTTCTGCTTCGGCAAGCATGGCTAAAGCGCAGCATACGGCTCAGAATGCCGAT
GACGAGGCCAAGTCACGTATCACAAAGTTGGACAAGAGTCGATTGGAGGAACTATTCTCTTCCAAACTGAGATTG
GCTGCGTCTACCAACAACTATGATGATTTTATCCAACATCTCAAGTCCCTATCGCCCTCTAGTGCCGATATCGAA
TTGCGTTCTCTATCGTTGGGTGCTGGCGGCCAAGATGATACAAATGATCTTTTCCACTTTATCCGAGCCTTGACG
GCGCAGCTCAAAGCTAGGAAGGATTATGAGTTGACACAAGCATGGATGACTGTATTTCTTCGTCTGCATTCTGAC
ATTATCATGGCAAGCGACGCCCTCATGAAGGCACTGGGCGAATGGAAGGTGCAGCAGGAACTCGAGTGCGAGCGG
TTGAATGGTCTGGTAGGCTACTGCAGCGGCGTGGTAGGCTTTCTTAAAAGTCCGCGGACATGA
Gene >OphauB2|1250
ATGCCGCATTCGAGCCTTGACTCGCCGCTGGCCAAGCGCCAGAAGCTGTCGGGCATCACTCCGTCTGCAAACTCG
GCAGTCAATTCGTCGCGCATCTTTGCTCCTTTTCGGGTATGTCGCCTCAAAGCCCTACACTATGCGCTGCTGGCA
ATCTGATTTCTTACAGACTGTTGGGCTCGTCTCCCCCACGAGCGTCCCCTTCACATTGGTTCCTCTGGGAAAAAC
CAGCTATCAAATCACCACTTCGGTTGGTCGAGCGCTTCAGACATACGACTTGCGCCGAGGCTTGAATCTCGTCTT
CGTCACGCGCCCCCAGACGCCTTTTGACATCACAGCTTCCCATGCATGGAAGGAAAAGCTACTTGCCGCATGGGG
CGGCTCTCGGGCTGGCGAAGCCCAAGGCCTCTGGATCTATCAACGAGGCCACAAGATTTATGAACTTGCCCCGCC
CTCAGATCTCTCGGAGCCCATTACTCAAATTCTCGCTTTCGGCACTTGGATCGTTGCTGCTGCTTCTACGAGAAT
CGAGATTTTCAAATTTACAACCTTTGAACACTACACCACCATACACACCATGACATCAGCCAACCAAGGCCATCG
CATTACCGGCGGCATCACCAATATGCCAACATATCTGAACAAGATTCTCGTGGGCCGCAACGACGGCTGGGTTGA
GATTTGGAACATTAGTACTGGCAAGCTCATCTACACCATTCTCCCCCCTTCCCCGGACTCTGGCTTCGTCACGTG
TATGGAGCCGGCTCCTGCTCTCTCTCTTGTGGCAATAGCTTACTCGACTGGACTGCTGGTGGTGAGCAACATTTT
GACCGATCAGTCCATCATACAAGTCGACGCAGGAAGCGAGGAGGCACCTGTCAACAGTATATCTTTTAGGACTGA
TGGCATAGGTGCTGGTCAGGACGGCAGGAAGGACGGCGTAATGGCTACTACGACGTCGGCCACTGGAGACGTGAC
GTTTTGGGATTTGAATCGAGGCGGCCGTGTCATGGGAGTCCTGCGCAGTGCCCACAATCCTCCAAGTAGAGACGG
CTCCAATGTTGGAGGAGGAATAAGCAAAGCTACCTTTTTGGCGGGCCAGCCAATCATCATCACCAGTGGATACGA
CAACTCGCTCAAATCGTGGATCTTTGACAAGACGCCCTTCTCGCCAGTGCCTAGGATTCTGCATACACGCAGTGG
TCATGCTGGGGCTGTGAATTGCCTCCACTTTCTCCCCACAGATTTCGATGGTGCTGAAGCGGGTAATAAATGGAT
TCTTAGCGGAGGCCGGGACAGGAGCCTTTGGGGCTGGAGTCTTCGTCGTGATGGTCAAAGCACGGAGCTCAGCCA
GGGAAATGTTCGCAAAAAGGCCAAAAAAGTTGGCATTCTGGCTGCTAATGCTCTAGCTCACGGTCCTACAACAAC
GCTAGAAGACCTCAAGGCCCCAGAAATTACTTGCATTGCCTCATGCCTGAACCGAGATGGTGGTATTGGCGCCAT
GCCCGGAAAACAGCCAATATGGCAAAAAGACCAAAAGAGCACAAAGGCCCCCGACGCAGAAGTCAGTAGCATGAC
GGGATGGGAAAGCGTTGTTACAGCACACAAAAACGACAAGTATGCTCGCACCTGGTTCTGGGGCAGGAAGCGGGC
AGGACGATGGGCCCTTCCAAGTGGCGACGGCACTCATGTGTCAACCGTTGCTATGAGTCCCTGCGGATCCTTTGC
CGTTGTTGGCTCCGAGGGGGGAAGCGTCATCATGTACAACCTCCAATCTGGCTCGGTCCGACATCGCTTCCCGTC
ACGGTTAACGCCCTCGCAAGCACGCCAGGTTCGACAACTACAGCTAAAGCAGGCAGATGATGTTAGTCTACTACA
GTCCGAGACGGGCACTGGCAAATTCCCTCCCGGCACTGGCAAACACACCAAAGCTGTGACGGGCATAGTTGTCGA
CTCGTTGAATAAGCATCTTGTTACATGTGCGCTCGACGGCAAAATCAAGTTTTGGCACTTTTTGACGGGCACCTT
GCTGGAGCAGCTGGATTGGTCACCCATGACAAGTCCGATCCTTTGCAGATATCAGGCCTCGAGCAGCTTGATGGC
CTTCGCTTGCGACGACATGTCGGTTCGCATTGTCGACATGGACACCAAGAAGACAATTCGAGAGCTCTGGGGTCC
GCGTGACACCATCAACGATCTTTGCTTTTCAAACGATGGGCGTTGGATCATGGCTGCTTCGCGAGACGCAATCAT
TCGAGTCTGGGATCTGCCAACAAGCCACCTAATTGACGCAATTCGATTGGAAAGGCCCTGTACCGCCATCTCCAT
GTCTAACACTGGTGAATATTTGGCTGCGACTATAGAAAACGAGCCAGGCGTAGCCATTTGGACGAATAAGGCGCT
CTTTAAACATGTGTCTACGCGACAGATATCAGAAAAGGAGATTGCTTCGCTTTCGCTCCCCTCTCTCTCGGGAGA
AGGTAATCAAGGTCTTTTGGAGAGCGCCTTTGAAGCTAATGAGCAAGACGCGGACGATGCTGTTGTGGCACCAAG
CATCGACCAGCTCAGCTCGGATCTGATGACCCTGAGTCTGGTTCCTAAAAGCCGATGGCAAACATTGTTGCATCT
TGACCTTGTCCGAGAACGTAACAAGCCCAAGGAGCCGCCCAAGGCACCTGACAAGGCTCCATTTTTCCTCCCCTC
TGTTTCTGCTTCGGCAAGCATGGCTAAAGCGCAGCATACGGCTCAGAATGCCGATGACGAGGCCAAGTCACGTAT
CACAAAGTTGGACAAGAGTCGATTGGAGGAACTATTCTCTTCCAAACTGAGATTGGCTGCGTCTACCAACAACTG
TGAGATGACAATTTCATTTGTAGTCTGTCCATATTTTTCCGAGGCTAATAATGTTTCACCAGATGATGATTTTAT
CCAACATCTCAAGTCCCTATCGCCCTCTAGTGCCGATATCGAATTGCGTTCTCTATCGTTGGGTGCTGGCGGCCA
AGATGATACAAATGATCTTTTCCACTTTATCCGAGCCTTGACGGCGCAGCTCAAAGCTAGGAAGGATTATGAGTT
GACACAAGCATGGATGACTGTATTTCTTCGTCTGCATTCTGACATTATCATGGCAAGCGACGCCCTCATGAAGGC
ACTGGGCGAATGGAAGGTGCAGCAGGAACTCGAGTGCGAGCGGTTGAATGGTCTGGTAGGCTACTGCAGCGGCGT
GGTAGGCTTTCTTAAAAGTCCGCGGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail