Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1245
Gene name
LocationContig_13:170216..172118
Strand+
Gene length (bp)1902
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01018 GTP1_OBG GTP1/OBG 3.2E-30 55 148
PF01018 GTP1_OBG GTP1/OBG 3.8E-08 319 374
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.0E-22 377 501

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 239 632 1.0E-39
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 304 495 5.0E-36
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 314 505 9.0E-36
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 301 506 1.0E-35
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 301 506 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 239 632 1.0E-39
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 304 495 5.0E-36
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 314 505 9.0E-36
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 301 506 1.0E-35
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 301 506 1.0E-35
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 301 631 6.0E-35
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 301 631 6.0E-35
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 313 628 8.0E-35
sp|B3EP74|OBG_CHLPB GTPase Obg OS=Chlorobium phaeobacteroides (strain BS1) GN=obg PE=3 SV=1 317 513 1.0E-34
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 304 537 2.0E-34
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 304 537 2.0E-34
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 301 504 2.0E-34
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 322 535 3.0E-34
sp|P38860|MTG2_YEAST GTPase MTG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG2 PE=1 SV=2 321 508 3.0E-34
sp|Q054P6|OBG_LEPBL GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=obg PE=3 SV=1 305 504 3.0E-34
sp|Q04Q90|OBG_LEPBJ GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=obg PE=3 SV=1 305 504 3.0E-34
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 316 631 7.0E-34
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 316 631 7.0E-34
sp|Q30QP0|OBG_SULDN GTPase Obg OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=obg PE=3 SV=1 319 505 8.0E-34
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 329 631 1.0E-33
sp|Q8F7U0|OBG_LEPIN GTPase Obg OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=obg PE=3 SV=1 305 504 2.0E-33
sp|Q72NQ7|OBG_LEPIC GTPase Obg OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=obg PE=3 SV=1 305 504 2.0E-33
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 304 534 2.0E-33
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 289 526 2.0E-33
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 328 628 6.0E-33
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 302 631 6.0E-33
sp|B1VGL9|OBG_CORU7 GTPase Obg OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=obg PE=3 SV=1 317 516 7.0E-33
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 329 484 7.0E-33
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 289 526 8.0E-33
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 316 494 1.0E-32
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 304 553 1.0E-32
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 304 553 1.0E-32
sp|B3WE52|OBG_LACCB GTPase Obg OS=Lactobacillus casei (strain BL23) GN=obg PE=3 SV=1 316 631 1.0E-32
sp|Q039J3|OBG_LACC3 GTPase Obg OS=Lactobacillus casei (strain ATCC 334) GN=obg PE=3 SV=1 316 631 2.0E-32
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 293 526 2.0E-32
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 301 624 2.0E-32
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 329 505 2.0E-32
sp|B4S5P1|OBG_PROA2 GTPase Obg OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=obg PE=3 SV=1 316 559 3.0E-32
sp|Q9RY66|OBG_DEIRA GTPase Obg OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=obg PE=3 SV=1 302 504 4.0E-32
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 316 505 4.0E-32
sp|Q88VG4|OBG_LACPL GTPase Obg OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=obg PE=3 SV=1 329 631 4.0E-32
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 304 486 5.0E-32
sp|B3QRD8|OBG_CHLP8 GTPase Obg OS=Chlorobaculum parvum (strain NCIB 8327) GN=obg PE=3 SV=1 317 501 6.0E-32
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 328 544 6.0E-32
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 288 631 6.0E-32
sp|A0RR37|OBG_CAMFF GTPase Obg OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=obg PE=3 SV=1 251 486 7.0E-32
sp|F4HSD4|OBGM_ARATH Probable GTP-binding protein OBGM, mitochondrial OS=Arabidopsis thaliana GN=ATOBGM PE=2 SV=1 319 488 8.0E-32
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 304 561 1.0E-31
sp|Q5LRY4|OBG_RUEPO GTPase Obg OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=obg PE=3 SV=1 301 521 1.0E-31
sp|Q89ZI9|OBG_BACTN GTPase Obg OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=obg PE=3 SV=1 291 536 1.0E-31
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 304 525 1.0E-31
sp|B7KIC1|OBG_CYAP7 GTPase Obg OS=Cyanothece sp. (strain PCC 7424) GN=obg PE=3 SV=1 304 506 2.0E-31
sp|Q3YRX8|OBG_EHRCJ GTPase Obg OS=Ehrlichia canis (strain Jake) GN=obg PE=3 SV=1 312 530 2.0E-31
sp|Q8KAF0|OBG_CHLTE GTPase Obg OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=obg PE=3 SV=1 316 501 2.0E-31
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 331 533 2.0E-31
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 304 557 2.0E-31
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 331 486 3.0E-31
sp|Q2QZ37|OBGM_ORYSJ Probable GTP-binding protein OBGM, mitochondrial OS=Oryza sativa subsp. japonica GN=OBGM PE=2 SV=1 322 487 3.0E-31
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 322 487 3.0E-31
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 304 532 3.0E-31
sp|A4G8R4|OBG_HERAR GTPase Obg OS=Herminiimonas arsenicoxydans GN=obg PE=3 SV=1 305 492 3.0E-31
sp|A6T2D5|OBG_JANMA GTPase Obg OS=Janthinobacterium sp. (strain Marseille) GN=obg PE=3 SV=1 305 492 4.0E-31
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 317 537 4.0E-31
sp|Q68VS1|OBG_RICTY GTPase Obg OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=obg PE=3 SV=1 293 555 4.0E-31
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 322 570 4.0E-31
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 304 504 4.0E-31
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 319 586 4.0E-31
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 322 620 4.0E-31
sp|A8F478|OBG_PSELT GTPase Obg OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=obg PE=3 SV=1 279 561 5.0E-31
sp|B2IYX1|OBG_NOSP7 GTPase Obg OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=obg PE=3 SV=1 301 506 6.0E-31
sp|Q043W1|OBG_LACGA GTPase Obg OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=obg PE=3 SV=1 329 630 7.0E-31
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 343 633 7.0E-31
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 316 521 7.0E-31
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 322 631 7.0E-31
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 311 506 8.0E-31
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 311 506 8.0E-31
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 304 531 8.0E-31
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 304 531 8.0E-31
sp|B2GBD0|OBG_LACF3 GTPase Obg OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=obg PE=3 SV=1 316 586 9.0E-31
sp|Q74JN7|OBG_LACJO GTPase Obg OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=obg PE=3 SV=1 316 589 1.0E-30
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 312 509 1.0E-30
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 317 497 1.0E-30
sp|A4JBB8|OBG_BURVG GTPase Obg OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=obg PE=3 SV=1 305 486 1.0E-30
sp|B4SBR3|OBG_PELPB GTPase Obg OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=obg PE=3 SV=1 322 501 1.0E-30
sp|Q9ZMD3|OBG_HELPJ GTPase Obg OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=obg PE=3 SV=1 321 486 1.0E-30
sp|Q2GGS7|OBG_EHRCR GTPase Obg OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=obg PE=3 SV=1 312 530 1.0E-30
sp|P72931|OBG_SYNY3 GTPase Obg OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=obg PE=3 SV=1 322 506 1.0E-30
sp|B0JI21|OBG_MICAN GTPase Obg OS=Microcystis aeruginosa (strain NIES-843) GN=obg PE=3 SV=1 322 506 1.0E-30
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 329 513 2.0E-30
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 331 487 2.0E-30
sp|Q39JU7|OBG_BURL3 GTPase Obg OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=obg PE=3 SV=1 305 486 2.0E-30
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 319 487 2.0E-30
sp|O25074|OBG_HELPY GTPase Obg OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=obg PE=3 SV=1 321 486 2.0E-30
sp|B2USD4|OBG_HELPS GTPase Obg OS=Helicobacter pylori (strain Shi470) GN=obg PE=3 SV=1 321 486 2.0E-30
sp|B4U7P8|OBG_HYDS0 GTPase Obg OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=obg PE=3 SV=1 301 504 2.0E-30
sp|A4SCP4|OBG_CHLPM GTPase Obg OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=obg PE=3 SV=1 322 483 2.0E-30
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 322 631 2.0E-30
sp|Q38WT4|OBG_LACSS GTPase Obg OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=obg PE=3 SV=1 322 631 2.0E-30
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 301 530 2.0E-30
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 301 631 2.0E-30
sp|A5WFV1|OBG_PSYWF GTPase Obg OS=Psychrobacter sp. (strain PRwf-1) GN=obg PE=3 SV=1 301 485 2.0E-30
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 301 497 2.0E-30
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 301 494 3.0E-30
sp|B5ZA69|OBG_HELPG GTPase Obg OS=Helicobacter pylori (strain G27) GN=obg PE=3 SV=1 321 486 3.0E-30
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 302 585 3.0E-30
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 301 505 3.0E-30
sp|Q17Y93|OBG_HELAH GTPase Obg OS=Helicobacter acinonychis (strain Sheeba) GN=obg PE=3 SV=1 317 486 4.0E-30
sp|Q1CUK0|OBG_HELPH GTPase Obg OS=Helicobacter pylori (strain HPAG1) GN=obg PE=3 SV=1 321 486 4.0E-30
sp|Q82V20|OBG_NITEU GTPase Obg OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=obg PE=3 SV=1 312 486 4.0E-30
sp|Q73LW4|OBG_TREDE GTPase Obg OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=obg PE=3 SV=1 316 587 4.0E-30
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 314 631 4.0E-30
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 316 627 4.0E-30
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 316 486 4.0E-30
sp|A1BJ56|OBG_CHLPD GTPase Obg OS=Chlorobium phaeobacteroides (strain DSM 266) GN=obg PE=3 SV=1 322 501 5.0E-30
sp|Q7MA28|OBG_WOLSU GTPase Obg OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=obg PE=3 SV=1 319 486 5.0E-30
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 301 494 5.0E-30
sp|B6JKN2|OBG_HELP2 GTPase Obg OS=Helicobacter pylori (strain P12) GN=obg PE=3 SV=1 321 486 5.0E-30
sp|Q9HVL8|OBG_PSEAE GTPase Obg OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=obg PE=3 SV=1 322 513 5.0E-30
sp|Q02GB1|OBG_PSEAB GTPase Obg OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=obg PE=1 SV=1 322 513 5.0E-30
sp|B7V0A9|OBG_PSEA8 GTPase Obg OS=Pseudomonas aeruginosa (strain LESB58) GN=obg PE=3 SV=1 322 513 5.0E-30
sp|A1R0K4|OBG_BORT9 GTPase Obg OS=Borrelia turicatae (strain 91E135) GN=obg PE=3 SV=1 336 504 5.0E-30
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 301 511 6.0E-30
sp|A6VBV3|OBG_PSEA7 GTPase Obg OS=Pseudomonas aeruginosa (strain PA7) GN=obg PE=3 SV=1 322 513 6.0E-30
sp|B8J4L3|OBG_DESDA GTPase Obg OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=obg PE=3 SV=1 311 485 6.0E-30
sp|A4SVA3|OBG_POLSQ GTPase Obg OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=obg PE=3 SV=1 312 486 6.0E-30
sp|Q3B6H6|OBG_CHLL7 GTPase Obg OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=obg PE=3 SV=1 329 513 6.0E-30
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 317 487 6.0E-30
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 343 631 6.0E-30
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 343 631 6.0E-30
sp|B2S1C3|OBG_BORHD GTPase Obg OS=Borrelia hermsii (strain HS1 / DAH) GN=obg PE=3 SV=1 336 504 7.0E-30
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 331 487 7.0E-30
sp|B5RMX3|OBG_BORDL GTPase Obg OS=Borrelia duttonii (strain Ly) GN=obg PE=3 SV=1 336 504 7.0E-30
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 304 550 7.0E-30
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 304 550 7.0E-30
sp|B1X580|OBG_PAUCH Putative GTPase Obg OS=Paulinella chromatophora GN=obg PE=3 SV=1 310 534 8.0E-30
sp|B5RQB8|OBG_BORRA GTPase Obg OS=Borrelia recurrentis (strain A1) GN=obg PE=3 SV=1 336 504 8.0E-30
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 305 500 9.0E-30
sp|Q9PJX7|OBG_CHLMU GTPase Obg OS=Chlamydia muridarum (strain MoPn / Nigg) GN=obg PE=3 SV=1 322 487 9.0E-30
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 322 513 9.0E-30
sp|B1XT35|OBG_POLNS GTPase Obg OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=obg PE=3 SV=1 312 513 1.0E-29
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 316 504 1.0E-29
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 314 486 1.0E-29
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 293 506 1.0E-29
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 343 628 1.0E-29
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 343 628 1.0E-29
sp|A9NF57|OBG_ACHLI GTPase Obg OS=Acholeplasma laidlawii (strain PG-8A) GN=obg PE=3 SV=1 329 561 1.0E-29
sp|Q5GTG3|OBG_WOLTR GTPase Obg OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=obg PE=3 SV=1 301 504 1.0E-29
sp|B1X0M2|OBG_CYAA5 GTPase Obg OS=Cyanothece sp. (strain ATCC 51142) GN=obg PE=3 SV=1 312 506 1.0E-29
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 301 486 2.0E-29
sp|B3QVU6|OBG_CHLT3 GTPase Obg OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=obg PE=3 SV=1 329 483 2.0E-29
sp|Q13U15|OBG_BURXL GTPase Obg OS=Burkholderia xenovorans (strain LB400) GN=obg PE=3 SV=1 305 513 2.0E-29
sp|A4XYL2|OBG_PSEMY GTPase Obg OS=Pseudomonas mendocina (strain ymp) GN=obg PE=3 SV=1 322 534 2.0E-29
sp|Q10XA1|OBG_TRIEI GTPase Obg OS=Trichodesmium erythraeum (strain IMS101) GN=obg PE=3 SV=1 322 511 2.0E-29
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 316 504 2.0E-29
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 316 504 2.0E-29
sp|B2SYV2|OBG_BURPP GTPase Obg OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=obg PE=3 SV=1 305 535 2.0E-29
sp|B2UCV3|OBG_RALPJ GTPase Obg OS=Ralstonia pickettii (strain 12J) GN=obg PE=3 SV=1 322 486 3.0E-29
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 343 506 3.0E-29
sp|Q2GK25|OBG_ANAPZ GTPase Obg OS=Anaplasma phagocytophilum (strain HZ) GN=obg PE=3 SV=1 304 530 3.0E-29
sp|B2VGT5|OBG_ERWT9 GTPase Obg OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=obg PE=3 SV=1 301 486 3.0E-29
sp|Q3AM97|OBG_SYNSC GTPase Obg OS=Synechococcus sp. (strain CC9605) GN=obg PE=3 SV=1 310 539 3.0E-29
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 308 487 3.0E-29
sp|B0VCR5|OBG_ACIBY GTPase Obg OS=Acinetobacter baumannii (strain AYE) GN=obg PE=3 SV=1 301 485 3.0E-29
sp|A3M7M2|OBG_ACIBT GTPase Obg OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=obg PE=3 SV=2 301 485 3.0E-29
sp|B2HWM9|OBG_ACIBC GTPase Obg OS=Acinetobacter baumannii (strain ACICU) GN=obg PE=3 SV=1 301 485 3.0E-29
sp|B7I557|OBG_ACIB5 GTPase Obg OS=Acinetobacter baumannii (strain AB0057) GN=obg PE=3 SV=1 301 485 3.0E-29
sp|B7GYV1|OBG_ACIB3 GTPase Obg OS=Acinetobacter baumannii (strain AB307-0294) GN=obg PE=3 SV=1 301 485 3.0E-29
sp|B8DRN9|OBG_DESVM GTPase Obg OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=obg PE=3 SV=1 322 485 3.0E-29
sp|Q2SZG0|OBG_BURTA GTPase Obg OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=obg PE=3 SV=1 305 486 3.0E-29
sp|Q1IW72|OBG_DEIGD GTPase Obg OS=Deinococcus geothermalis (strain DSM 11300) GN=obg PE=3 SV=1 301 486 3.0E-29
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 301 486 3.0E-29
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 331 484 3.0E-29
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 305 505 3.0E-29
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 291 530 3.0E-29
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 301 513 3.0E-29
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 331 484 3.0E-29
sp|A9AXD9|OBG_HERA2 GTPase Obg OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=obg PE=3 SV=1 321 484 3.0E-29
sp|B0VTQ1|OBG_ACIBS GTPase Obg OS=Acinetobacter baumannii (strain SDF) GN=obg PE=3 SV=1 301 485 3.0E-29
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 331 484 3.0E-29
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 302 483 3.0E-29
sp|A6QB70|OBG_SULNB GTPase Obg OS=Sulfurovum sp. (strain NBC37-1) GN=obg PE=3 SV=1 321 484 3.0E-29
sp|A0M5C6|OBG_GRAFK GTPase Obg OS=Gramella forsetii (strain KT0803) GN=obg PE=3 SV=1 329 483 3.0E-29
sp|B8ZPS8|OBG_STRPJ GTPase Obg OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=obg PE=3 SV=1 316 631 3.0E-29
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 316 504 3.0E-29
sp|A1VK90|OBG_POLNA GTPase Obg OS=Polaromonas naphthalenivorans (strain CJ2) GN=obg PE=3 SV=1 301 486 3.0E-29
sp|Q8XVL0|OBG_RALSO GTPase Obg OS=Ralstonia solanacearum (strain GMI1000) GN=obg PE=3 SV=1 322 486 4.0E-29
sp|A9H0F1|OBG_GLUDA GTPase Obg OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=obg PE=3 SV=2 322 504 4.0E-29
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 316 603 4.0E-29
sp|Q6NFV7|OBG_CORDI GTPase Obg OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=obg PE=3 SV=1 312 516 4.0E-29
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 316 486 4.0E-29
sp|A3NDS7|OBG_BURP6 GTPase Obg OS=Burkholderia pseudomallei (strain 668) GN=obg PE=3 SV=1 305 486 4.0E-29
sp|A9VIR5|OBG_BACWK GTPase Obg OS=Bacillus weihenstephanensis (strain KBAB4) GN=obg PE=3 SV=1 314 631 4.0E-29
sp|Q87BL2|OBG_XYLFT GTPase Obg OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=obg PE=3 SV=1 331 487 4.0E-29
sp|B2I6V6|OBG_XYLF2 GTPase Obg OS=Xylella fastidiosa (strain M23) GN=obg PE=3 SV=1 331 487 4.0E-29
sp|Q8DUU2|OBG_STRMU GTPase Obg OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=obg PE=3 SV=1 301 631 4.0E-29
sp|A4D1E9|GTPBA_HUMAN GTP-binding protein 10 OS=Homo sapiens GN=GTPBP10 PE=1 SV=1 331 627 4.0E-29
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 316 487 4.0E-29
sp|Q2NW34|OBG_SODGM GTPase Obg OS=Sodalis glossinidius (strain morsitans) GN=obg PE=3 SV=1 301 486 4.0E-29
sp|C0R5N5|OBG_WOLWR GTPase Obg OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=obg PE=3 SV=1 321 532 5.0E-29
sp|Q63QM0|OBG_BURPS GTPase Obg OS=Burkholderia pseudomallei (strain K96243) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|Q3JNG0|OBG_BURP1 GTPase Obg OS=Burkholderia pseudomallei (strain 1710b) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|A3NZJ0|OBG_BURP0 GTPase Obg OS=Burkholderia pseudomallei (strain 1106a) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|A1V0P1|OBG_BURMS GTPase Obg OS=Burkholderia mallei (strain SAVP1) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|Q62GV4|OBG_BURMA GTPase Obg OS=Burkholderia mallei (strain ATCC 23344) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|A2S5R8|OBG_BURM9 GTPase Obg OS=Burkholderia mallei (strain NCTC 10229) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|A3MR90|OBG_BURM7 GTPase Obg OS=Burkholderia mallei (strain NCTC 10247) GN=obg PE=3 SV=1 305 486 5.0E-29
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 343 631 5.0E-29
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 316 487 5.0E-29
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 343 585 5.0E-29
sp|Q2S3C0|OBG_SALRD GTPase Obg OS=Salinibacter ruber (strain DSM 13855 / M31) GN=obg PE=3 SV=1 316 501 6.0E-29
sp|Q49Y82|OBG_STAS1 GTPase Obg OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=obg PE=3 SV=1 343 633 6.0E-29
sp|O84423|OBG_CHLTR GTPase Obg OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=obg PE=3 SV=1 322 487 6.0E-29
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 301 526 6.0E-29
sp|Q3KLT5|OBG_CHLTA GTPase Obg OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=obg PE=3 SV=1 322 487 6.0E-29
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 322 485 6.0E-29
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 322 485 6.0E-29
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 308 487 7.0E-29
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 343 631 7.0E-29
sp|C1DEA4|OBG_AZOVD GTPase Obg OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=obg PE=3 SV=1 322 535 7.0E-29
sp|Q1MA76|OBG_RHIL3 GTPase Obg OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=obg PE=3 SV=1 304 531 7.0E-29
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 313 487 7.0E-29
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 308 487 7.0E-29
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 308 487 7.0E-29
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 308 487 7.0E-29
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 316 603 8.0E-29
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 322 628 8.0E-29
sp|A6Q4D2|OBG_NITSB GTPase Obg OS=Nitratiruptor sp. (strain SB155-2) GN=obg PE=3 SV=1 316 487 8.0E-29
sp|Q2K2X6|OBG_RHIEC GTPase Obg OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=obg PE=3 SV=1 304 531 8.0E-29
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 328 526 8.0E-29
sp|B5ZUE3|OBG_RHILW GTPase Obg OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=obg PE=3 SV=1 304 531 9.0E-29
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 322 511 9.0E-29
sp|B0BC53|OBG_CHLTB GTPase Obg OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=obg PE=3 SV=1 322 487 1.0E-28
sp|B0B7Y8|OBG_CHLT2 GTPase Obg OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=obg PE=3 SV=1 322 487 1.0E-28
sp|Q9PAS3|OBG_XYLFA GTPase Obg OS=Xylella fastidiosa (strain 9a5c) GN=obg PE=3 SV=2 331 487 1.0E-28
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 316 631 1.0E-28
sp|Q31IT4|OBG_THICR GTPase Obg OS=Thiomicrospira crunogena (strain XCL-2) GN=obg PE=3 SV=1 329 497 1.0E-28
sp|B7JVH9|OBG_CYAP8 GTPase Obg OS=Cyanothece sp. (strain PCC 8801) GN=obg PE=3 SV=1 329 506 1.0E-28
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 343 631 1.0E-28
sp|A8EV83|OBG_ARCB4 GTPase Obg OS=Arcobacter butzleri (strain RM4018) GN=obg PE=3 SV=1 305 506 1.0E-28
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 289 504 1.0E-28
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 316 631 1.0E-28
sp|Q46HF4|OBG_PROMT GTPase Obg OS=Prochlorococcus marinus (strain NATL2A) GN=obg PE=3 SV=1 310 530 1.0E-28
sp|Q97QW8|OBG_STRPN GTPase Obg OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=obg PE=3 SV=1 316 631 1.0E-28
sp|B5E4J4|OBG_STRP4 GTPase Obg OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=obg PE=3 SV=1 316 631 1.0E-28
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 322 525 1.0E-28
sp|B1IBL9|OBG_STRPI GTPase Obg OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=obg PE=3 SV=1 316 631 1.0E-28
sp|Q73HQ3|OBG_WOLPM GTPase Obg OS=Wolbachia pipientis wMel GN=obg PE=3 SV=1 321 532 1.0E-28
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 322 485 1.0E-28
sp|B2IQ29|OBG_STRPS GTPase Obg OS=Streptococcus pneumoniae (strain CGSP14) GN=obg PE=3 SV=1 316 631 1.0E-28
sp|B3PRZ3|OBG_RHIE6 GTPase Obg OS=Rhizobium etli (strain CIAT 652) GN=obg PE=3 SV=1 304 531 1.0E-28
sp|B3R898|OBG_CUPTR GTPase Obg OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=obg PE=3 SV=1 305 535 1.0E-28
sp|Q6F9D8|OBG_ACIAD GTPase Obg OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=obg PE=3 SV=1 301 485 2.0E-28
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 316 631 2.0E-28
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 316 631 2.0E-28
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 316 631 2.0E-28
sp|B3ER55|OBG_AMOA5 GTPase Obg OS=Amoebophilus asiaticus (strain 5a2) GN=obg PE=3 SV=1 295 506 2.0E-28
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 304 492 2.0E-28
sp|Q6F0U3|OBG_MESFL GTPase Obg OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=obg PE=3 SV=1 305 489 2.0E-28
sp|Q2GDW7|OBG_NEOSM GTPase Obg OS=Neorickettsia sennetsu (strain Miyayama) GN=obg PE=3 SV=1 322 555 2.0E-28
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 316 529 2.0E-28
sp|A2C050|OBG_PROM1 GTPase Obg OS=Prochlorococcus marinus (strain NATL1A) GN=obg PE=3 SV=1 310 530 2.0E-28
sp|Q8DPV8|OBG_STRR6 GTPase Obg OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=obg PE=3 SV=1 316 631 2.0E-28
sp|Q04KK7|OBG_STRP2 GTPase Obg OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=obg PE=3 SV=1 316 631 2.0E-28
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 322 495 2.0E-28
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 317 487 2.0E-28
sp|A6VMU1|OBG_ACTSZ GTPase Obg OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=obg PE=3 SV=1 305 518 2.0E-28
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 343 506 2.0E-28
sp|A1TYY4|OBG_MARHV GTPase Obg OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=obg PE=3 SV=1 322 529 2.0E-28
sp|Q31CW3|OBG_PROM9 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9312) GN=obg PE=3 SV=1 316 529 2.0E-28
sp|Q3APF4|OBG_CHLCH GTPase Obg OS=Chlorobium chlorochromatii (strain CaD3) GN=obg PE=3 SV=1 317 598 2.0E-28
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 329 526 2.0E-28
sp|B2JHD7|OBG_BURP8 GTPase Obg OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=obg PE=3 SV=1 305 486 2.0E-28
sp|Q5R039|OBG_IDILO GTPase Obg OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=obg PE=3 SV=1 305 492 3.0E-28
sp|B7IIV2|OBG_BACC2 GTPase Obg OS=Bacillus cereus (strain G9842) GN=obg PE=3 SV=1 314 631 3.0E-28
sp|A3PAT7|OBG_PROM0 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9301) GN=obg PE=3 SV=1 316 529 3.0E-28
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 316 486 3.0E-28
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 301 532 3.0E-28
sp|Q4ZYK1|OBG_PSEU2 GTPase Obg OS=Pseudomonas syringae pv. syringae (strain B728a) GN=obg PE=3 SV=1 322 539 3.0E-28
sp|Q48NL2|OBG_PSE14 GTPase Obg OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=obg PE=3 SV=1 322 539 3.0E-28
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 301 496 3.0E-28
sp|Q1JLA1|OBG_STRPC GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=obg PE=3 SV=1 316 631 3.0E-28
sp|Q1JBB7|OBG_STRPB GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=obg PE=3 SV=1 316 631 3.0E-28
sp|Q99Z94|OBG_STRP1 GTPase Obg OS=Streptococcus pyogenes serotype M1 GN=obg PE=3 SV=1 316 631 3.0E-28
sp|A2RE30|OBG_STRPG GTPase Obg OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=obg PE=3 SV=1 316 631 3.0E-28
sp|B3CNP2|OBG_WOLPP GTPase Obg OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=obg PE=3 SV=1 301 555 3.0E-28
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 329 485 3.0E-28
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 331 550 3.0E-28
sp|Q3ZAJ2|OBG_DEHM1 GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=obg PE=3 SV=1 332 504 3.0E-28
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 313 494 3.0E-28
sp|Q4AAV4|OBG_MYCHJ GTPase Obg OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=obg PE=3 SV=1 328 489 3.0E-28
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 301 532 4.0E-28
sp|Q602A7|OBG_MYCH2 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 232) GN=obg PE=3 SV=1 328 489 4.0E-28
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 343 631 4.0E-28
sp|Q4FRK6|OBG_PSYA2 GTPase Obg OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=obg PE=3 SV=1 329 485 4.0E-28
sp|Q1QA43|OBG_PSYCK GTPase Obg OS=Psychrobacter cryohalolentis (strain K5) GN=obg PE=3 SV=1 329 485 4.0E-28
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 332 530 4.0E-28
sp|Q8P0I6|OBG_STRP8 GTPase Obg OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=obg PE=3 SV=1 316 631 4.0E-28
sp|B0U3R3|OBG_XYLFM GTPase Obg OS=Xylella fastidiosa (strain M12) GN=obg PE=3 SV=1 331 487 4.0E-28
sp|Q46X17|OBG_CUPPJ GTPase Obg OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=obg PE=3 SV=1 305 531 4.0E-28
sp|Q48SX8|OBG_STRPM GTPase Obg OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=obg PE=3 SV=1 316 631 4.0E-28
sp|Q5XBM1|OBG_STRP6 GTPase Obg OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=obg PE=3 SV=1 316 631 4.0E-28
sp|Q4A8X1|OBG_MYCH7 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 7448) GN=obg PE=3 SV=1 328 489 4.0E-28
sp|Q1J652|OBG_STRPF GTPase Obg OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=obg PE=3 SV=1 316 631 4.0E-28
sp|Q7V368|OBG_PROMP GTPase Obg OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=obg PE=3 SV=1 316 529 4.0E-28
sp|Q0SM73|OBG_BORAP GTPase Obg OS=Borrelia afzelii (strain PKo) GN=obg PE=3 SV=1 289 506 4.0E-28
sp|Q11Z03|OBG_CYTH3 GTPase Obg OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=obg PE=3 SV=1 329 483 4.0E-28
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 331 484 4.0E-28
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 322 486 4.0E-28
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 285 487 4.0E-28
sp|Q1R0C0|OBG_CHRSD GTPase Obg OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=obg PE=3 SV=1 311 513 5.0E-28
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 343 631 5.0E-28
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 312 587 5.0E-28
sp|Q03JJ8|OBG_STRTD GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=obg PE=3 SV=1 343 631 5.0E-28
sp|Q5M3C8|OBG_STRT2 GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=obg PE=3 SV=1 343 631 5.0E-28
sp|Q5LYR4|OBG_STRT1 GTPase Obg OS=Streptococcus thermophilus (strain CNRZ 1066) GN=obg PE=3 SV=1 343 631 5.0E-28
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 329 486 6.0E-28
sp|B9KER3|OBG_CAMLR GTPase Obg OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=obg PE=3 SV=1 305 484 6.0E-28
sp|B0CDA2|OBG_ACAM1 GTPase Obg OS=Acaryochloris marina (strain MBIC 11017) GN=obg PE=3 SV=1 308 506 6.0E-28
sp|Q0K6P6|OBG_CUPNH GTPase Obg OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=obg PE=3 SV=1 305 513 6.0E-28
sp|B1JF57|OBG_PSEPW GTPase Obg OS=Pseudomonas putida (strain W619) GN=obg PE=3 SV=1 301 513 6.0E-28
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 346 631 6.0E-28
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 343 631 6.0E-28
sp|A7MJF1|OBG_CROS8 GTPase Obg OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=obg PE=3 SV=1 304 485 6.0E-28
sp|B9IZ16|OBG_BACCQ GTPase Obg OS=Bacillus cereus (strain Q1) GN=obg PE=3 SV=1 343 631 6.0E-28
sp|P0CB41|OBG_CAUCR GTPase Obg OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=obg PE=3 SV=1 331 531 7.0E-28
sp|B8GYI7|OBG_CAUCN GTPase Obg/CgtA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cgtA PE=1 SV=1 331 531 7.0E-28
sp|Q5RDW1|MTG2_PONAB Mitochondrial ribosome-associated GTPase 2 OS=Pongo abelii GN=MTG2 PE=2 SV=1 343 585 7.0E-28
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 343 631 7.0E-28
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 343 633 7.0E-28
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 343 633 7.0E-28
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 301 507 7.0E-28
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 316 631 7.0E-28
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 343 631 8.0E-28
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 343 631 8.0E-28
sp|Q88Q08|OBG_PSEPK GTPase Obg OS=Pseudomonas putida (strain KT2440) GN=obg PE=3 SV=1 301 513 8.0E-28
sp|A5VYC6|OBG_PSEP1 GTPase Obg OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=obg PE=3 SV=1 301 513 8.0E-28
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 319 486 8.0E-28
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 316 631 8.0E-28
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 343 545 9.0E-28
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 334 536 9.0E-28
sp|A7H029|OBG_CAMC5 GTPase Obg OS=Campylobacter curvus (strain 525.92) GN=obg PE=3 SV=1 245 486 9.0E-28
sp|A9FJF8|OBG_SORC5 GTPase Obg OS=Sorangium cellulosum (strain So ce56) GN=obg PE=3 SV=1 304 585 1.0E-27
sp|Q72ZY5|OBG_BACC1 GTPase Obg OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=obg PE=3 SV=1 314 631 1.0E-27
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 322 631 1.0E-27
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 304 484 1.0E-27
sp|B0KMF6|OBG_PSEPG GTPase Obg OS=Pseudomonas putida (strain GB-1) GN=obg PE=3 SV=1 301 513 1.0E-27
sp|Q4JWT6|OBG_CORJK GTPase Obg OS=Corynebacterium jeikeium (strain K411) GN=obg PE=3 SV=1 312 487 1.0E-27
sp|A8FRU4|OBG_SHESH GTPase Obg OS=Shewanella sediminis (strain HAW-EB3) GN=obg PE=3 SV=1 322 485 1.0E-27
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 334 536 1.0E-27
sp|B4U3Q7|OBG_STREM GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=obg PE=3 SV=1 316 631 1.0E-27
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 321 483 1.0E-27
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 310 492 1.0E-27
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 322 531 1.0E-27
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 322 496 1.0E-27
sp|A2BP15|OBG_PROMS GTPase Obg OS=Prochlorococcus marinus (strain AS9601) GN=obg PE=3 SV=1 316 529 1.0E-27
sp|Q6HD85|OBG_BACHK GTPase Obg OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=obg PE=3 SV=1 343 631 1.0E-27
sp|Q634A3|OBG_BACCZ GTPase Obg OS=Bacillus cereus (strain ZK / E33L) GN=obg PE=3 SV=1 343 631 1.0E-27
sp|C1ETN7|OBG_BACC3 GTPase Obg OS=Bacillus cereus (strain 03BB102) GN=obg PE=3 SV=1 343 631 1.0E-27
sp|A0RJ47|OBG_BACAH GTPase Obg OS=Bacillus thuringiensis (strain Al Hakam) GN=obg PE=3 SV=1 343 631 1.0E-27
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 333 518 1.0E-27
sp|Q9H4K7|MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens GN=MTG2 PE=1 SV=1 343 585 1.0E-27
sp|A4VI54|OBG_PSEU5 GTPase Obg OS=Pseudomonas stutzeri (strain A1501) GN=obg PE=3 SV=1 322 513 1.0E-27
sp|B7JQ26|OBG_BACC0 GTPase Obg OS=Bacillus cereus (strain AH820) GN=obg PE=3 SV=1 343 631 1.0E-27
sp|Q81LF0|OBG_BACAN GTPase Obg OS=Bacillus anthracis GN=obg PE=3 SV=1 343 631 1.0E-27
sp|P0DB53|OBG_STRPQ GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=obg PE=3 SV=1 316 585 1.0E-27
sp|P0DB52|OBG_STRP3 GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=obg PE=3 SV=1 316 585 1.0E-27
sp|Q1IF13|OBG_PSEE4 GTPase Obg OS=Pseudomonas entomophila (strain L48) GN=obg PE=3 SV=1 301 513 1.0E-27
sp|B5Y805|OBG_COPPD GTPase Obg OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=obg PE=3 SV=1 321 502 2.0E-27
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 312 486 2.0E-27
sp|B4RZH3|OBG_ALTMD GTPase Obg OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=obg1 PE=3 SV=1 305 485 2.0E-27
sp|Q3ZW89|OBG_DEHMC GTPase Obg OS=Dehalococcoides mccartyi (strain CBDB1) GN=obg PE=3 SV=1 332 504 2.0E-27
sp|A5FP49|OBG_DEHMB GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=obg PE=3 SV=1 332 504 2.0E-27
sp|Q30XW0|OBG_DESAG GTPase Obg OS=Desulfovibrio alaskensis (strain G20) GN=obg PE=3 SV=2 322 485 2.0E-27
sp|A8AWM9|OBG_STRGC GTPase Obg OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=obg PE=3 SV=1 316 631 2.0E-27
sp|Q817U6|OBG_BACCR GTPase Obg OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=obg PE=3 SV=1 343 631 2.0E-27
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 301 486 2.0E-27
sp|B7HQJ8|OBG_BACC7 GTPase Obg OS=Bacillus cereus (strain AH187) GN=obg PE=3 SV=1 343 631 2.0E-27
sp|A6TEK2|OBG_KLEP7 GTPase Obg OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=obg PE=3 SV=1 304 485 2.0E-27
sp|C0MBS1|OBG_STRE4 GTPase Obg OS=Streptococcus equi subsp. equi (strain 4047) GN=obg PE=3 SV=1 316 631 2.0E-27
sp|B5XSV8|OBG_KLEP3 GTPase Obg OS=Klebsiella pneumoniae (strain 342) GN=obg PE=3 SV=1 304 485 2.0E-27
sp|Q3J6S0|OBG_NITOC GTPase Obg OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=obg PE=3 SV=1 288 501 2.0E-27
sp|B0SRT7|OBG_LEPBP GTPase Obg OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=obg PE=3 SV=1 329 484 2.0E-27
sp|B0S9A3|OBG_LEPBA GTPase Obg OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=obg PE=3 SV=1 329 484 2.0E-27
sp|Q65S59|OBG_MANSM GTPase Obg OS=Mannheimia succiniciproducens (strain MBEL55E) GN=obg PE=3 SV=1 305 530 2.0E-27
sp|A3CM33|OBG_STRSV GTPase Obg OS=Streptococcus sanguinis (strain SK36) GN=obg PE=3 SV=1 316 631 2.0E-27
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 304 485 2.0E-27
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 305 506 3.0E-27
sp|Q98QK8|OBG_MYCPU GTPase Obg OS=Mycoplasma pulmonis (strain UAB CTIP) GN=obg PE=3 SV=1 328 523 3.0E-27
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 328 506 3.0E-27
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 328 506 3.0E-27
sp|Q3K6K9|OBG_PSEPF GTPase Obg OS=Pseudomonas fluorescens (strain Pf0-1) GN=obg PE=3 SV=1 322 535 3.0E-27
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 305 506 3.0E-27
sp|B1XN32|OBG_SYNP2 GTPase Obg OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=obg PE=3 SV=1 345 506 3.0E-27
sp|A9VYM4|OBG_METEP GTPase Obg OS=Methylobacterium extorquens (strain PA1) GN=obg PE=3 SV=1 312 520 3.0E-27
sp|B7KSH0|OBG_METC4 GTPase Obg OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=obg PE=3 SV=1 312 520 3.0E-27
sp|A8G2M6|OBG_PROM2 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9215) GN=obg PE=3 SV=1 316 529 3.0E-27
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 304 504 3.0E-27
sp|A7I166|OBG_CAMHC GTPase Obg OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=obg PE=3 SV=1 342 486 3.0E-27
sp|Q65GM7|OBG_BACLD GTPase Obg OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=obg PE=3 SV=1 322 633 3.0E-27
sp|Q92BH7|OBG_LISIN GTPase Obg OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=obg PE=3 SV=1 316 628 4.0E-27
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 332 506 4.0E-27
sp|Q8Y6Z3|OBG_LISMO GTPase Obg OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=obg PE=3 SV=1 316 628 4.0E-27
sp|Q71ZD3|OBG_LISMF GTPase Obg OS=Listeria monocytogenes serotype 4b (strain F2365) GN=obg PE=3 SV=1 316 628 4.0E-27
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 316 505 4.0E-27
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 304 486 4.0E-27
sp|Q7ND61|OBG_GLOVI GTPase Obg OS=Gloeobacter violaceus (strain PCC 7421) GN=obg PE=3 SV=1 322 506 4.0E-27
sp|B8DHL1|OBG_LISMH GTPase Obg OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=obg PE=3 SV=1 316 628 5.0E-27
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 297 495 5.0E-27
sp|Q9CNS4|OBG_PASMU GTPase Obg OS=Pasteurella multocida (strain Pm70) GN=obg PE=3 SV=1 305 486 5.0E-27
sp|B3PIU9|OBG_CELJU GTPase Obg OS=Cellvibrio japonicus (strain Ueda107) GN=obg PE=3 SV=1 322 513 6.0E-27
sp|A8FFS8|OBG_BACP2 GTPase Obg OS=Bacillus pumilus (strain SAFR-032) GN=obg PE=3 SV=1 322 633 6.0E-27
sp|Q4K5T8|OBG_PSEF5 GTPase Obg OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=obg PE=3 SV=1 322 513 6.0E-27
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 316 560 6.0E-27
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 289 505 6.0E-27
sp|B7HE73|OBG_BACC4 GTPase Obg OS=Bacillus cereus (strain B4264) GN=obg PE=3 SV=1 343 631 7.0E-27
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 289 505 7.0E-27
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 289 505 7.0E-27
sp|Q1LIQ0|OBG_CUPMC GTPase Obg OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=obg PE=3 SV=1 305 486 7.0E-27
sp|Q65ZZ3|OBG_BORBP GTPase Obg OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=obg PE=3 SV=1 336 526 7.0E-27
sp|A8Z6G0|OBG_CAMC1 GTPase Obg OS=Campylobacter concisus (strain 13826) GN=obg PE=3 SV=1 343 484 8.0E-27
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 331 516 8.0E-27
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 301 505 8.0E-27
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 322 631 9.0E-27
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 317 497 1.0E-26
sp|Q3MHG6|GTPBA_BOVIN GTP-binding protein 10 OS=Bos taurus GN=GTPBP10 PE=2 SV=1 331 627 1.0E-26
sp|B4F2A8|OBG_PROMH GTPase Obg OS=Proteus mirabilis (strain HI4320) GN=obg PE=3 SV=1 301 485 1.0E-26
sp|B1ZL15|OBG_METPB GTPase Obg OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=obg PE=3 SV=1 312 504 1.0E-26
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 331 486 1.0E-26
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 301 534 1.0E-26
sp|A4WEZ6|OBG_ENT38 GTPase Obg OS=Enterobacter sp. (strain 638) GN=obg PE=3 SV=1 304 485 1.0E-26
sp|B7J0M7|OBG_BORBZ GTPase Obg OS=Borrelia burgdorferi (strain ZS7) GN=obg PE=3 SV=1 305 506 2.0E-26
sp|O51722|OBG_BORBU GTPase Obg OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=obg PE=3 SV=1 305 506 2.0E-26
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 316 631 2.0E-26
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 291 511 2.0E-26
sp|A0AIY6|OBG_LISW6 GTPase Obg OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=obg PE=3 SV=1 316 628 2.0E-26
sp|B8D7S4|OBG_BUCAT GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=obg PE=3 SV=1 322 505 2.0E-26
sp|P57469|OBG_BUCAI GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=obg PE=3 SV=1 322 505 2.0E-26
sp|B8D9H2|OBG_BUCA5 GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=obg PE=3 SV=1 322 505 2.0E-26
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 322 505 2.0E-26
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 305 485 2.0E-26
sp|Q0BRE9|OBG_GRABC GTPase Obg OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=obg PE=3 SV=2 301 505 2.0E-26
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 312 627 2.0E-26
sp|A7Z781|OBG_BACMF GTPase Obg OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=obg PE=3 SV=1 322 631 2.0E-26
sp|Q64XA5|OBG_BACFR GTPase Obg OS=Bacteroides fragilis (strain YCH46) GN=obg PE=3 SV=1 343 536 2.0E-26
sp|Q5LGG9|OBG_BACFN GTPase Obg OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=obg PE=3 SV=2 343 536 2.0E-26
sp|Q605N2|OBG_METCA GTPase Obg OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=obg PE=3 SV=1 322 485 2.0E-26
sp|Q6G4Z2|OBG_BARHE GTPase Obg OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=obg PE=3 SV=1 301 531 2.0E-26
sp|Q02XY2|OBG_LACLS GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=obg PE=3 SV=1 288 585 2.0E-26
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 343 633 2.0E-26
sp|A2RJQ6|OBG_LACLM GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=obg PE=3 SV=1 288 585 2.0E-26
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 343 581 3.0E-26
sp|Q6YRC6|OBG_ONYPE GTPase Obg OS=Onion yellows phytoplasma (strain OY-M) GN=obg PE=3 SV=1 328 504 3.0E-26
sp|A6W352|OBG_MARMS GTPase Obg OS=Marinomonas sp. (strain MWYL1) GN=obg PE=3 SV=1 304 486 3.0E-26
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 322 483 3.0E-26
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 301 496 3.0E-26
sp|A1URN4|OBG_BARBK GTPase Obg OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=obg PE=3 SV=1 305 531 3.0E-26
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 332 505 3.0E-26
sp|Q6MGS5|OBG_BDEBA GTPase Obg OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=obg PE=3 SV=2 343 512 3.0E-26
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 332 505 3.0E-26
sp|Q9CF94|OBG_LACLA GTPase Obg OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=obg PE=3 SV=1 288 585 3.0E-26
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 291 548 4.0E-26
sp|A1JIV6|OBG_YERE8 GTPase Obg OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=obg PE=3 SV=1 301 486 4.0E-26
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 343 487 5.0E-26
sp|B4SP14|OBG_STRM5 GTPase Obg OS=Stenotrophomonas maltophilia (strain R551-3) GN=obg PE=3 SV=1 322 566 5.0E-26
sp|Q2NIK0|OBG_AYWBP GTPase Obg OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=obg PE=3 SV=1 328 504 5.0E-26
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 328 511 6.0E-26
sp|B3DPS4|OBG_BIFLD GTPase Obg OS=Bifidobacterium longum (strain DJO10A) GN=obg PE=3 SV=1 332 505 6.0E-26
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 347 506 6.0E-26
sp|Q8EPQ0|OBG_OCEIH GTPase Obg OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=obg PE=3 SV=1 291 587 6.0E-26
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 331 532 7.0E-26
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 311 486 7.0E-26
sp|A1W4B0|OBG_ACISJ GTPase Obg OS=Acidovorax sp. (strain JS42) GN=obg PE=3 SV=2 317 486 7.0E-26
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 322 486 7.0E-26
sp|A4J7I9|OBG_DESRM GTPase Obg OS=Desulfotomaculum reducens (strain MI-1) GN=obg PE=3 SV=1 316 631 7.0E-26
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 322 532 8.0E-26
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 308 572 8.0E-26
sp|A7H1H0|OBG_CAMJD GTPase Obg OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=obg PE=3 SV=1 305 484 9.0E-26
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 322 532 9.0E-26
sp|A8FJQ1|OBG_CAMJ8 GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=obg PE=3 SV=1 305 484 9.0E-26
sp|Q5FUL2|OBG_GLUOX GTPase Obg OS=Gluconobacter oxydans (strain 621H) GN=obg PE=3 SV=2 329 484 9.0E-26
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 331 518 9.0E-26
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 301 532 1.0E-25
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 316 487 1.0E-25
sp|B3EHE6|OBG_CHLL2 GTPase Obg OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=obg PE=3 SV=1 322 489 1.0E-25
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 322 486 1.0E-25
sp|B2FTD3|OBG_STRMK GTPase Obg OS=Stenotrophomonas maltophilia (strain K279a) GN=obg PE=3 SV=1 322 486 1.0E-25
sp|A1WPR5|OBG_VEREI GTPase Obg OS=Verminephrobacter eiseniae (strain EF01-2) GN=obg PE=3 SV=1 312 493 1.0E-25
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 316 492 1.0E-25
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 285 487 1.0E-25
sp|B9KIJ7|OBG1_ANAMF GTPase Obg 1 OS=Anaplasma marginale (strain Florida) GN=obg1 PE=3 SV=1 304 530 1.0E-25
sp|B1JMI3|OBG_YERPY GTPase Obg OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=obg PE=3 SV=1 301 486 1.0E-25
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 53 146 2.0E-13
sp|Q8KAF0|OBG_CHLTE GTPase Obg OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=obg PE=3 SV=1 51 149 5.0E-13
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 51 144 1.0E-12
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 51 148 1.0E-12
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 52 148 2.0E-12
sp|B3EHE6|OBG_CHLL2 GTPase Obg OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=obg PE=3 SV=1 51 147 2.0E-12
sp|B3QRD8|OBG_CHLP8 GTPase Obg OS=Chlorobaculum parvum (strain NCIB 8327) GN=obg PE=3 SV=1 51 147 3.0E-12
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 51 148 3.0E-12
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 53 148 3.0E-12
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 52 148 5.0E-12
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 52 148 5.0E-12
sp|A4SCP4|OBG_CHLPM GTPase Obg OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=obg PE=3 SV=1 51 147 1.0E-11
sp|A1BJ56|OBG_CHLPD GTPase Obg OS=Chlorobium phaeobacteroides (strain DSM 266) GN=obg PE=3 SV=1 51 153 1.0E-11
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 51 148 1.0E-11
sp|B3EP74|OBG_CHLPB GTPase Obg OS=Chlorobium phaeobacteroides (strain BS1) GN=obg PE=3 SV=1 51 147 2.0E-11
sp|A8FRU4|OBG_SHESH GTPase Obg OS=Shewanella sediminis (strain HAW-EB3) GN=obg PE=3 SV=1 51 144 2.0E-11
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 53 148 2.0E-11
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 53 148 2.0E-11
sp|B0VTQ1|OBG_ACIBS GTPase Obg OS=Acinetobacter baumannii (strain SDF) GN=obg PE=3 SV=1 51 146 3.0E-11
sp|B3QVU6|OBG_CHLT3 GTPase Obg OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=obg PE=3 SV=1 53 154 4.0E-11
sp|B0VCR5|OBG_ACIBY GTPase Obg OS=Acinetobacter baumannii (strain AYE) GN=obg PE=3 SV=1 51 146 4.0E-11
sp|A3M7M2|OBG_ACIBT GTPase Obg OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=obg PE=3 SV=2 51 146 4.0E-11
sp|B2HWM9|OBG_ACIBC GTPase Obg OS=Acinetobacter baumannii (strain ACICU) GN=obg PE=3 SV=1 51 146 4.0E-11
sp|B7I557|OBG_ACIB5 GTPase Obg OS=Acinetobacter baumannii (strain AB0057) GN=obg PE=3 SV=1 51 146 4.0E-11
sp|B7GYV1|OBG_ACIB3 GTPase Obg OS=Acinetobacter baumannii (strain AB307-0294) GN=obg PE=3 SV=1 51 146 4.0E-11
sp|Q605N2|OBG_METCA GTPase Obg OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=obg PE=3 SV=1 51 148 5.0E-11
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 51 149 6.0E-11
sp|A1TYY4|OBG_MARHV GTPase Obg OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=obg PE=3 SV=1 51 153 6.0E-11
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 51 148 7.0E-11
sp|A8F478|OBG_PSELT GTPase Obg OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=obg PE=3 SV=1 52 148 8.0E-11
sp|B2VGT5|OBG_ERWT9 GTPase Obg OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=obg PE=3 SV=1 51 144 8.0E-11
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 53 148 9.0E-11
sp|B2FTD3|OBG_STRMK GTPase Obg OS=Stenotrophomonas maltophilia (strain K279a) GN=obg PE=3 SV=1 51 149 9.0E-11
sp|B4S5P1|OBG_PROA2 GTPase Obg OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=obg PE=3 SV=1 51 147 1.0E-10
sp|Q6NFV7|OBG_CORDI GTPase Obg OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=obg PE=3 SV=1 53 146 1.0E-10
sp|Q6F9D8|OBG_ACIAD GTPase Obg OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=obg PE=3 SV=1 51 153 1.0E-10
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 53 148 1.0E-10
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 53 158 1.0E-10
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 53 158 1.0E-10
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 51 148 1.0E-10
sp|B4F2A8|OBG_PROMH GTPase Obg OS=Proteus mirabilis (strain HI4320) GN=obg PE=3 SV=1 51 149 1.0E-10
sp|B4SP14|OBG_STRM5 GTPase Obg OS=Stenotrophomonas maltophilia (strain R551-3) GN=obg PE=3 SV=1 51 149 1.0E-10
sp|B8J4L3|OBG_DESDA GTPase Obg OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=obg PE=3 SV=1 51 146 2.0E-10
sp|Q3B6H6|OBG_CHLL7 GTPase Obg OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=obg PE=3 SV=1 51 147 2.0E-10
sp|Q9PJX7|OBG_CHLMU GTPase Obg OS=Chlamydia muridarum (strain MoPn / Nigg) GN=obg PE=3 SV=1 53 168 2.0E-10
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 51 144 2.0E-10
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 51 153 2.0E-10
sp|A4J7I9|OBG_DESRM GTPase Obg OS=Desulfotomaculum reducens (strain MI-1) GN=obg PE=3 SV=1 53 148 2.0E-10
sp|B1JMI3|OBG_YERPY GTPase Obg OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=obg PE=3 SV=1 51 146 2.0E-10
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 53 146 3.0E-10
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 53 146 3.0E-10
sp|Q5R039|OBG_IDILO GTPase Obg OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=obg PE=3 SV=1 51 149 3.0E-10
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 51 148 3.0E-10
sp|A1JIV6|OBG_YERE8 GTPase Obg OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=obg PE=3 SV=1 51 146 3.0E-10
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 51 148 4.0E-10
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 51 148 4.0E-10
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 51 148 4.0E-10
sp|Q3KLT5|OBG_CHLTA GTPase Obg OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=obg PE=3 SV=1 53 168 4.0E-10
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 51 167 4.0E-10
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 51 167 4.0E-10
sp|B4SBR3|OBG_PELPB GTPase Obg OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=obg PE=3 SV=1 51 147 5.0E-10
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 51 149 5.0E-10
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 51 149 5.0E-10
sp|Q1R0C0|OBG_CHRSD GTPase Obg OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=obg PE=3 SV=1 51 146 5.0E-10
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 51 153 5.0E-10
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 51 148 6.0E-10
sp|B4RZH3|OBG_ALTMD GTPase Obg OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=obg1 PE=3 SV=1 51 144 6.0E-10
sp|Q3ZW89|OBG_DEHMC GTPase Obg OS=Dehalococcoides mccartyi (strain CBDB1) GN=obg PE=3 SV=1 55 145 7.0E-10
sp|A5FP49|OBG_DEHMB GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=obg PE=3 SV=1 55 145 7.0E-10
sp|A6Q4D2|OBG_NITSB GTPase Obg OS=Nitratiruptor sp. (strain SB155-2) GN=obg PE=3 SV=1 53 148 8.0E-10
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 51 148 8.0E-10
sp|A7MJF1|OBG_CROS8 GTPase Obg OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=obg PE=3 SV=1 51 146 8.0E-10
sp|Q5GTG3|OBG_WOLTR GTPase Obg OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=obg PE=3 SV=1 51 144 9.0E-10
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 51 146 9.0E-10
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 51 148 1.0E-09
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 51 148 1.0E-09
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 51 148 1.0E-09
sp|Q87BL2|OBG_XYLFT GTPase Obg OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=obg PE=3 SV=1 51 149 1.0E-09
sp|B2I6V6|OBG_XYLF2 GTPase Obg OS=Xylella fastidiosa (strain M23) GN=obg PE=3 SV=1 51 149 1.0E-09
sp|Q2NW34|OBG_SODGM GTPase Obg OS=Sodalis glossinidius (strain morsitans) GN=obg PE=3 SV=1 51 146 1.0E-09
sp|O84423|OBG_CHLTR GTPase Obg OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=obg PE=3 SV=1 53 168 1.0E-09
sp|Q9PAS3|OBG_XYLFA GTPase Obg OS=Xylella fastidiosa (strain 9a5c) GN=obg PE=3 SV=2 51 149 1.0E-09
sp|B3CNP2|OBG_WOLPP GTPase Obg OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=obg PE=3 SV=1 51 144 1.0E-09
sp|B0U3R3|OBG_XYLFM GTPase Obg OS=Xylella fastidiosa (strain M12) GN=obg PE=3 SV=1 51 149 1.0E-09
sp|A6TEK2|OBG_KLEP7 GTPase Obg OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=obg PE=3 SV=1 51 146 1.0E-09
sp|B5XSV8|OBG_KLEP3 GTPase Obg OS=Klebsiella pneumoniae (strain 342) GN=obg PE=3 SV=1 51 146 1.0E-09
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 53 148 1.0E-09
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 51 146 1.0E-09
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 53 147 2.0E-09
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 50 149 2.0E-09
sp|Q3APF4|OBG_CHLCH GTPase Obg OS=Chlorobium chlorochromatii (strain CaD3) GN=obg PE=3 SV=1 51 147 2.0E-09
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 51 153 2.0E-09
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 51 144 2.0E-09
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 53 146 2.0E-09
sp|Q3ZAJ2|OBG_DEHM1 GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=obg PE=3 SV=1 55 145 2.0E-09
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 51 148 2.0E-09
sp|A4WEZ6|OBG_ENT38 GTPase Obg OS=Enterobacter sp. (strain 638) GN=obg PE=3 SV=1 51 146 2.0E-09
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 51 149 3.0E-09
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 51 148 3.0E-09
sp|B0BC53|OBG_CHLTB GTPase Obg OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=obg PE=3 SV=1 53 168 3.0E-09
sp|B0B7Y8|OBG_CHLT2 GTPase Obg OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=obg PE=3 SV=1 53 168 3.0E-09
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 51 148 3.0E-09
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 51 146 3.0E-09
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 52 147 3.0E-09
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 53 146 4.0E-09
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 51 144 4.0E-09
sp|B8DRN9|OBG_DESVM GTPase Obg OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=obg PE=3 SV=1 51 149 4.0E-09
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 51 146 4.0E-09
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 51 146 4.0E-09
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 51 148 4.0E-09
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 51 146 4.0E-09
sp|B1VGL9|OBG_CORU7 GTPase Obg OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=obg PE=3 SV=1 53 146 5.0E-09
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 51 148 5.0E-09
sp|A7I166|OBG_CAMHC GTPase Obg OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=obg PE=3 SV=1 53 148 5.0E-09
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 53 149 6.0E-09
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 51 198 6.0E-09
sp|C0R5N5|OBG_WOLWR GTPase Obg OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=obg PE=3 SV=1 53 143 6.0E-09
sp|Q73HQ3|OBG_WOLPM GTPase Obg OS=Wolbachia pipientis wMel GN=obg PE=3 SV=1 53 143 6.0E-09
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 50 147 6.0E-09
sp|Q9CNS4|OBG_PASMU GTPase Obg OS=Pasteurella multocida (strain Pm70) GN=obg PE=3 SV=1 51 144 7.0E-09
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 53 148 8.0E-09
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 53 149 8.0E-09
sp|Q30XW0|OBG_DESAG GTPase Obg OS=Desulfovibrio alaskensis (strain G20) GN=obg PE=3 SV=2 51 148 8.0E-09
sp|A9VYM4|OBG_METEP GTPase Obg OS=Methylobacterium extorquens (strain PA1) GN=obg PE=3 SV=1 51 146 8.0E-09
sp|B7KSH0|OBG_METC4 GTPase Obg OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=obg PE=3 SV=1 51 146 8.0E-09
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 53 149 9.0E-09
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 52 149 9.0E-09
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 53 148 9.0E-09
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 53 170 1.0E-08
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 53 146 1.0E-08
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 53 146 1.0E-08
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 51 163 1.0E-08
sp|Q73LW4|OBG_TREDE GTPase Obg OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=obg PE=3 SV=1 51 148 1.0E-08
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 53 148 1.0E-08
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 53 149 1.0E-08
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 53 149 1.0E-08
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 53 148 1.0E-08
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 51 148 1.0E-08
sp|A6VMU1|OBG_ACTSZ GTPase Obg OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=obg PE=3 SV=1 51 144 1.0E-08
sp|Q4JWT6|OBG_CORJK GTPase Obg OS=Corynebacterium jeikeium (strain K411) GN=obg PE=3 SV=1 53 146 1.0E-08
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 51 148 1.0E-08
sp|B1ZL15|OBG_METPB GTPase Obg OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=obg PE=3 SV=1 51 146 1.0E-08
sp|B8D7S4|OBG_BUCAT GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=obg PE=3 SV=1 51 146 1.0E-08
sp|P57469|OBG_BUCAI GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=obg PE=3 SV=1 51 146 1.0E-08
sp|B8D9H2|OBG_BUCA5 GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=obg PE=3 SV=1 51 146 1.0E-08
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 51 146 1.0E-08
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 51 153 1.0E-08
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 52 149 2.0E-08
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 51 148 2.0E-08
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 51 148 2.0E-08
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 53 149 2.0E-08
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 53 149 2.0E-08
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 52 149 2.0E-08
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 52 148 2.0E-08
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 51 168 3.0E-08
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 51 162 3.0E-08
sp|Q65S59|OBG_MANSM GTPase Obg OS=Mannheimia succiniciproducens (strain MBEL55E) GN=obg PE=3 SV=1 51 144 3.0E-08
sp|Q3K6K9|OBG_PSEPF GTPase Obg OS=Pseudomonas fluorescens (strain Pf0-1) GN=obg PE=3 SV=1 51 159 3.0E-08
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 51 198 4.0E-08
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 51 146 4.0E-08
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 51 148 4.0E-08
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 53 148 4.0E-08
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 53 149 4.0E-08
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 53 149 4.0E-08
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 53 159 4.0E-08
sp|Q3J6S0|OBG_NITOC GTPase Obg OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=obg PE=3 SV=1 51 150 4.0E-08
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 51 144 4.0E-08
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 53 149 5.0E-08
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 51 144 5.0E-08
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 51 144 5.0E-08
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 53 148 6.0E-08
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 51 153 6.0E-08
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 53 148 7.0E-08
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 51 144 7.0E-08
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 53 152 7.0E-08
sp|P38860|MTG2_YEAST GTPase MTG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG2 PE=1 SV=2 52 147 8.0E-08
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 51 148 8.0E-08
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 51 148 9.0E-08
sp|Q5LRY4|OBG_RUEPO GTPase Obg OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=obg PE=3 SV=1 51 144 9.0E-08
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 51 146 9.0E-08
sp|B4U7P8|OBG_HYDS0 GTPase Obg OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=obg PE=3 SV=1 51 146 9.0E-08
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 53 149 9.0E-08
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 53 149 9.0E-08
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 53 148 9.0E-08
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 52 149 9.0E-08
sp|Q49Y82|OBG_STAS1 GTPase Obg OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=obg PE=3 SV=1 53 147 9.0E-08
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 51 198 1.0E-07
sp|Q82V20|OBG_NITEU GTPase Obg OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=obg PE=3 SV=1 51 146 1.0E-07
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 51 148 1.0E-07
sp|A1VK90|OBG_POLNA GTPase Obg OS=Polaromonas naphthalenivorans (strain CJ2) GN=obg PE=3 SV=1 51 148 1.0E-07
sp|Q2K2X6|OBG_RHIEC GTPase Obg OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=obg PE=3 SV=1 51 148 1.0E-07
sp|Q88Q08|OBG_PSEPK GTPase Obg OS=Pseudomonas putida (strain KT2440) GN=obg PE=3 SV=1 51 146 1.0E-07
sp|A5VYC6|OBG_PSEP1 GTPase Obg OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=obg PE=3 SV=1 51 146 1.0E-07
sp|B0KMF6|OBG_PSEPG GTPase Obg OS=Pseudomonas putida (strain GB-1) GN=obg PE=3 SV=1 51 146 1.0E-07
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 53 146 1.0E-07
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 51 146 1.0E-07
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 53 148 1.0E-07
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 51 146 2.0E-07
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 53 149 2.0E-07
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 53 149 2.0E-07
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 53 146 2.0E-07
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 51 201 2.0E-07
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 51 201 2.0E-07
sp|B2GBD0|OBG_LACF3 GTPase Obg OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=obg PE=3 SV=1 52 149 2.0E-07
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 53 148 2.0E-07
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 51 146 2.0E-07
sp|Q31IT4|OBG_THICR GTPase Obg OS=Thiomicrospira crunogena (strain XCL-2) GN=obg PE=3 SV=1 53 149 2.0E-07
sp|A8EV83|OBG_ARCB4 GTPase Obg OS=Arcobacter butzleri (strain RM4018) GN=obg PE=3 SV=1 53 146 2.0E-07
sp|B3ER55|OBG_AMOA5 GTPase Obg OS=Amoebophilus asiaticus (strain 5a2) GN=obg PE=3 SV=1 49 166 2.0E-07
sp|B1JF57|OBG_PSEPW GTPase Obg OS=Pseudomonas putida (strain W619) GN=obg PE=3 SV=1 51 146 2.0E-07
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 51 149 2.0E-07
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 53 146 3.0E-07
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 53 146 3.0E-07
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 51 144 3.0E-07
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 51 146 3.0E-07
sp|A2BP15|OBG_PROMS GTPase Obg OS=Prochlorococcus marinus (strain AS9601) GN=obg PE=3 SV=1 53 149 3.0E-07
sp|Q1IF13|OBG_PSEE4 GTPase Obg OS=Pseudomonas entomophila (strain L48) GN=obg PE=3 SV=1 51 146 3.0E-07
sp|A8G2M6|OBG_PROM2 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9215) GN=obg PE=3 SV=1 53 149 3.0E-07
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 51 148 3.0E-07
sp|A1URN4|OBG_BARBK GTPase Obg OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=obg PE=3 SV=1 51 148 3.0E-07
sp|Q6MGS5|OBG_BDEBA GTPase Obg OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=obg PE=3 SV=2 51 149 3.0E-07
sp|Q68VS1|OBG_RICTY GTPase Obg OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=obg PE=3 SV=1 51 201 4.0E-07
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 53 148 4.0E-07
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 53 149 4.0E-07
sp|B3PRZ3|OBG_RHIE6 GTPase Obg OS=Rhizobium etli (strain CIAT 652) GN=obg PE=3 SV=1 51 148 4.0E-07
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 53 146 4.0E-07
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 51 148 4.0E-07
sp|Q9HVL8|OBG_PSEAE GTPase Obg OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=obg PE=3 SV=1 51 146 5.0E-07
sp|Q02GB1|OBG_PSEAB GTPase Obg OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=obg PE=1 SV=1 51 146 5.0E-07
sp|B7V0A9|OBG_PSEA8 GTPase Obg OS=Pseudomonas aeruginosa (strain LESB58) GN=obg PE=3 SV=1 51 146 5.0E-07
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 53 148 5.0E-07
sp|Q4ZYK1|OBG_PSEU2 GTPase Obg OS=Pseudomonas syringae pv. syringae (strain B728a) GN=obg PE=3 SV=1 51 146 5.0E-07
sp|Q48NL2|OBG_PSE14 GTPase Obg OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=obg PE=3 SV=1 51 146 5.0E-07
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 53 146 6.0E-07
sp|Q4K5T8|OBG_PSEF5 GTPase Obg OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=obg PE=3 SV=1 51 146 6.0E-07
sp|Q5FUL2|OBG_GLUOX GTPase Obg OS=Gluconobacter oxydans (strain 621H) GN=obg PE=3 SV=2 51 146 6.0E-07
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 51 201 7.0E-07
sp|A3PAT7|OBG_PROM0 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9301) GN=obg PE=3 SV=1 53 149 7.0E-07
sp|A4VI54|OBG_PSEU5 GTPase Obg OS=Pseudomonas stutzeri (strain A1501) GN=obg PE=3 SV=1 51 158 7.0E-07
sp|A6VBV3|OBG_PSEA7 GTPase Obg OS=Pseudomonas aeruginosa (strain PA7) GN=obg PE=3 SV=1 51 146 8.0E-07
sp|C1DEA4|OBG_AZOVD GTPase Obg OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=obg PE=3 SV=1 51 146 8.0E-07
sp|Q98QK8|OBG_MYCPU GTPase Obg OS=Mycoplasma pulmonis (strain UAB CTIP) GN=obg PE=3 SV=1 53 148 8.0E-07
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 53 148 9.0E-07
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 53 149 9.0E-07
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 53 148 9.0E-07
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 53 148 9.0E-07
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 53 146 1.0E-06
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 52 148 1.0E-06
sp|A1R0K4|OBG_BORT9 GTPase Obg OS=Borrelia turicatae (strain 91E135) GN=obg PE=3 SV=1 53 150 1.0E-06
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 53 148 1.0E-06
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 53 149 1.0E-06
sp|Q31CW3|OBG_PROM9 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9312) GN=obg PE=3 SV=1 53 149 1.0E-06
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 53 144 1.0E-06
sp|B5Y805|OBG_COPPD GTPase Obg OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=obg PE=3 SV=1 53 149 1.0E-06
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 52 148 1.0E-06
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 51 148 1.0E-06
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 51 148 1.0E-06
sp|Q6G4Z2|OBG_BARHE GTPase Obg OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=obg PE=3 SV=1 51 148 1.0E-06
sp|Q054P6|OBG_LEPBL GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=obg PE=3 SV=1 52 148 2.0E-06
sp|Q04Q90|OBG_LEPBJ GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=obg PE=3 SV=1 52 148 2.0E-06
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 51 170 2.0E-06
sp|P72931|OBG_SYNY3 GTPase Obg OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=obg PE=3 SV=1 51 149 2.0E-06
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 51 149 2.0E-06
sp|Q2S3C0|OBG_SALRD GTPase Obg OS=Salinibacter ruber (strain DSM 13855 / M31) GN=obg PE=3 SV=1 51 147 2.0E-06
sp|Q1LIQ0|OBG_CUPMC GTPase Obg OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=obg PE=3 SV=1 51 149 2.0E-06
sp|Q0BRE9|OBG_GRABC GTPase Obg OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=obg PE=3 SV=2 51 148 2.0E-06
sp|A1W4B0|OBG_ACISJ GTPase Obg OS=Acidovorax sp. (strain JS42) GN=obg PE=3 SV=2 51 148 2.0E-06
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 53 158 2.0E-06
sp|A1WPR5|OBG_VEREI GTPase Obg OS=Verminephrobacter eiseniae (strain EF01-2) GN=obg PE=3 SV=1 51 148 2.0E-06
sp|Q8F7U0|OBG_LEPIN GTPase Obg OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=obg PE=3 SV=1 52 148 3.0E-06
sp|Q72NQ7|OBG_LEPIC GTPase Obg OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=obg PE=3 SV=1 52 148 3.0E-06
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 51 198 3.0E-06
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 51 198 3.0E-06
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 51 198 3.0E-06
sp|Q9RY66|OBG_DEIRA GTPase Obg OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=obg PE=3 SV=1 53 144 3.0E-06
sp|A5WFV1|OBG_PSYWF GTPase Obg OS=Psychrobacter sp. (strain PRwf-1) GN=obg PE=3 SV=1 53 146 3.0E-06
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 53 148 3.0E-06
sp|B1X580|OBG_PAUCH Putative GTPase Obg OS=Paulinella chromatophora GN=obg PE=3 SV=1 51 149 3.0E-06
sp|A4XYL2|OBG_PSEMY GTPase Obg OS=Pseudomonas mendocina (strain ymp) GN=obg PE=3 SV=1 51 149 3.0E-06
sp|A9AXD9|OBG_HERA2 GTPase Obg OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=obg PE=3 SV=1 52 146 3.0E-06
sp|Q03JJ8|OBG_STRTD GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=obg PE=3 SV=1 53 148 3.0E-06
sp|Q5M3C8|OBG_STRT2 GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=obg PE=3 SV=1 53 148 3.0E-06
sp|Q5LYR4|OBG_STRT1 GTPase Obg OS=Streptococcus thermophilus (strain CNRZ 1066) GN=obg PE=3 SV=1 53 148 3.0E-06
sp|B4U3Q7|OBG_STREM GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=obg PE=3 SV=1 53 148 3.0E-06
sp|B9KIJ7|OBG1_ANAMF GTPase Obg 1 OS=Anaplasma marginale (strain Florida) GN=obg1 PE=3 SV=1 51 144 3.0E-06
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 53 148 4.0E-06
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 51 146 5.0E-06
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 51 148 5.0E-06
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 52 147 5.0E-06
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 52 147 5.0E-06
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 51 146 5.0E-06
sp|C0MBS1|OBG_STRE4 GTPase Obg OS=Streptococcus equi subsp. equi (strain 4047) GN=obg PE=3 SV=1 53 148 5.0E-06
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 52 148 6.0E-06
sp|Q48SX8|OBG_STRPM GTPase Obg OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=obg PE=3 SV=1 53 148 6.0E-06
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 53 148 6.0E-06
sp|A8AWM9|OBG_STRGC GTPase Obg OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=obg PE=3 SV=1 53 148 6.0E-06
sp|A3CM33|OBG_STRSV GTPase Obg OS=Streptococcus sanguinis (strain SK36) GN=obg PE=3 SV=1 53 148 6.0E-06
sp|A8FFS8|OBG_BACP2 GTPase Obg OS=Bacillus pumilus (strain SAFR-032) GN=obg PE=3 SV=1 53 146 6.0E-06
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 51 148 7.0E-06
sp|A4JBB8|OBG_BURVG GTPase Obg OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=obg PE=3 SV=1 51 149 7.0E-06
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q1JLA1|OBG_STRPC GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q1JBB7|OBG_STRPB GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q99Z94|OBG_STRP1 GTPase Obg OS=Streptococcus pyogenes serotype M1 GN=obg PE=3 SV=1 53 148 7.0E-06
sp|A2RE30|OBG_STRPG GTPase Obg OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q8P0I6|OBG_STRP8 GTPase Obg OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q5XBM1|OBG_STRP6 GTPase Obg OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|Q1J652|OBG_STRPF GTPase Obg OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|P0DB53|OBG_STRPQ GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|P0DB52|OBG_STRP3 GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=obg PE=3 SV=1 53 148 7.0E-06
sp|A7Z781|OBG_BACMF GTPase Obg OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=obg PE=3 SV=1 53 146 7.0E-06
sp|A7H1H0|OBG_CAMJD GTPase Obg OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=obg PE=3 SV=1 53 146 7.0E-06
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 51 148 8.0E-06
sp|Q2SZG0|OBG_BURTA GTPase Obg OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=obg PE=3 SV=1 51 149 8.0E-06
sp|A9H0F1|OBG_GLUDA GTPase Obg OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=obg PE=3 SV=2 51 144 8.0E-06
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 53 148 8.0E-06
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 53 148 8.0E-06
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 53 148 8.0E-06
sp|Q2GDW7|OBG_NEOSM GTPase Obg OS=Neorickettsia sennetsu (strain Miyayama) GN=obg PE=3 SV=1 51 144 8.0E-06
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 52 147 8.0E-06
sp|A8FJQ1|OBG_CAMJ8 GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=obg PE=3 SV=1 53 146 8.0E-06
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 52 149 9.0E-06
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 49 148 9.0E-06
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 49 148 9.0E-06
sp|Q8Y6Z3|OBG_LISMO GTPase Obg OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=obg PE=3 SV=1 53 149 9.0E-06
sp|Q71ZD3|OBG_LISMF GTPase Obg OS=Listeria monocytogenes serotype 4b (strain F2365) GN=obg PE=3 SV=1 53 149 9.0E-06
sp|B8DHL1|OBG_LISMH GTPase Obg OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=obg PE=3 SV=1 53 149 9.0E-06
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 51 154 1.0E-05
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 52 149 1.0E-05
sp|A0AIY6|OBG_LISW6 GTPase Obg OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=obg PE=3 SV=1 53 149 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1245
MVARPSLCRLAISRRCRAPLLHLPRCHRRHSTVNGLPESHLNPRPDDYAAVNFADRAQLTLYAGPGGSGCVSFQR
EAYLPDGPPNGGDGGAGGNIYIQAAPGETSLHKLARRTFVRAGRGKSGQGSSRNGVKGEDVILTVPVGTVVREIW
RHDPAVQEAALVHEWRKEKKLKKREKRLAQERAEAERKRMEAEAAVEQQLQEQQEADKRLDEFEDEDEVEDEVED
EVEEQQQEADQEEMDEQQQADNGGKHGKRRHKGKRQLDSKAEPEPEPDEQDQDQDPQHHKWILHPGMSKSDARSF
IFPEMPRRSRHLQQPAGPIRLDLTQPTQQPILLALGGVGGLGNPHFASRQSPHPLFATRGDEAMTMRLELELKLL
ADVGLVGLPNAGKSTLLRALTRSRTRVGSWAFTTLQPNIGTVVLDKYSGHPPVSRPSSGRSDEANAGPRSRFSVA
DIPGLIQGAHLDRGLGIAFLRHVERAAVLAFVIDLSAGNAVDALAALWHEVGLYAQMRDEQERARLQQEEEEQEQ
EHAQKTDAVLPVNLAITDDAAAPLQPASALHIAGKPWCVIATKADLPDTQQNFAQLKAHLDDVTKGRAAHPANVQ
GGWTTSVAAIPVSAIKGQGIDPIVHWIAGLLHA*
Coding >OphauB2|1245
ATGGTTGCCCGGCCGTCGCTCTGCCGCCTGGCCATCTCTAGACGGTGTAGAGCTCCCCTCCTCCATCTCCCACGA
TGCCATCGCCGCCATTCGACGGTCAATGGCCTGCCCGAGTCGCACCTCAATCCGCGTCCCGACGACTACGCCGCC
GTCAACTTTGCCGACCGCGCCCAGCTGACGCTCTACGCCGGTCCTGGTGGCAGCGGGTGCGTATCCTTTCAGCGC
GAGGCCTATCTGCCCGATGGACCTCCAAATGGCGGTGATGGCGGCGCCGGCGGCAACATCTACATCCAGGCTGCT
CCGGGCGAGACATCGCTGCACAAGCTGGCGCGTCGCACCTTTGTTCGTGCAGGGCGTGGCAAGAGCGGCCAAGGG
AGTTCCCGGAATGGCGTCAAAGGCGAGGATGTCATTTTGACGGTGCCTGTGGGCACTGTGGTGCGTGAGATTTGG
CGCCACGACCCGGCCGTCCAAGAAGCTGCCCTGGTGCACGAGTGGCGCAAGGAGAAGAAGTTGAAGAAGCGCGAG
AAGCGGCTTGCTCAAGAGCGGGCAGAGGCGGAGAGGAAGCGAATGGAAGCAGAGGCGGCCGTCGAGCAACAATTG
CAGGAGCAGCAAGAAGCGGACAAGCGCCTGGACGAATTCGAGGACGAGGACGAGGTGGAGGACGAGGTGGAGGAC
GAGGTGGAGGAGCAGCAACAAGAGGCCGACCAAGAAGAAATGGACGAGCAACAACAAGCTGACAATGGCGGCAAG
CATGGTAAGCGACGCCACAAAGGCAAACGACAATTAGACAGCAAAGCCGAGCCAGAGCCAGAGCCAGATGAACAA
GACCAAGACCAAGACCCCCAGCACCACAAATGGATCTTGCATCCCGGCATGTCAAAGTCGGATGCCAGAAGCTTC
ATCTTTCCCGAAATGCCTCGCCGCTCCCGCCATCTTCAGCAGCCTGCAGGCCCCATTCGCCTCGACCTGACGCAG
CCGACGCAGCAGCCCATTCTCCTTGCTCTTGGGGGAGTTGGCGGGCTGGGCAACCCGCACTTTGCCTCGCGCCAG
TCCCCGCACCCACTCTTTGCCACACGGGGAGACGAAGCCATGACGATGCGCCTAGAGCTCGAGCTCAAGCTGCTT
GCCGACGTGGGCCTCGTTGGCTTGCCCAATGCTGGCAAGAGCACCCTGTTGCGCGCTCTGACGCGCAGCCGCACG
CGTGTGGGCAGCTGGGCATTTACCACGCTGCAGCCAAACATTGGCACTGTTGTCCTCGACAAGTACTCGGGCCAT
CCCCCTGTGTCGAGGCCAAGCAGTGGGCGCAGCGACGAGGCGAATGCTGGGCCGCGCTCTCGCTTCAGCGTTGCC
GACATTCCAGGCCTGATTCAGGGCGCCCATCTGGACCGCGGCCTCGGCATCGCCTTTCTACGCCATGTTGAGCGC
GCTGCCGTCTTGGCCTTTGTCATTGACCTGTCTGCTGGCAACGCCGTCGACGCCCTCGCTGCCCTGTGGCACGAA
GTCGGGCTCTATGCGCAAATGCGCGACGAGCAGGAGCGCGCCCGCCTCCAACAAGAGGAGGAGGAGCAGGAGCAG
GAGCATGCCCAAAAGACTGATGCCGTGCTCCCCGTCAATCTGGCAATCACGGACGACGCTGCCGCGCCTTTGCAG
CCCGCCTCGGCCCTGCACATTGCCGGCAAGCCGTGGTGCGTCATTGCCACAAAGGCAGATTTACCAGACACGCAG
CAAAACTTTGCCCAGCTAAAGGCCCATCTTGATGACGTGACCAAGGGCCGCGCCGCACATCCTGCCAATGTCCAG
GGCGGCTGGACCACGAGTGTTGCCGCTATTCCCGTCAGTGCCATCAAGGGGCAAGGCATTGATCCCATTGTGCAC
TGGATCGCCGGCTTGCTCCACGCTTGA
Transcript >OphauB2|1245
ATGGTTGCCCGGCCGTCGCTCTGCCGCCTGGCCATCTCTAGACGGTGTAGAGCTCCCCTCCTCCATCTCCCACGA
TGCCATCGCCGCCATTCGACGGTCAATGGCCTGCCCGAGTCGCACCTCAATCCGCGTCCCGACGACTACGCCGCC
GTCAACTTTGCCGACCGCGCCCAGCTGACGCTCTACGCCGGTCCTGGTGGCAGCGGGTGCGTATCCTTTCAGCGC
GAGGCCTATCTGCCCGATGGACCTCCAAATGGCGGTGATGGCGGCGCCGGCGGCAACATCTACATCCAGGCTGCT
CCGGGCGAGACATCGCTGCACAAGCTGGCGCGTCGCACCTTTGTTCGTGCAGGGCGTGGCAAGAGCGGCCAAGGG
AGTTCCCGGAATGGCGTCAAAGGCGAGGATGTCATTTTGACGGTGCCTGTGGGCACTGTGGTGCGTGAGATTTGG
CGCCACGACCCGGCCGTCCAAGAAGCTGCCCTGGTGCACGAGTGGCGCAAGGAGAAGAAGTTGAAGAAGCGCGAG
AAGCGGCTTGCTCAAGAGCGGGCAGAGGCGGAGAGGAAGCGAATGGAAGCAGAGGCGGCCGTCGAGCAACAATTG
CAGGAGCAGCAAGAAGCGGACAAGCGCCTGGACGAATTCGAGGACGAGGACGAGGTGGAGGACGAGGTGGAGGAC
GAGGTGGAGGAGCAGCAACAAGAGGCCGACCAAGAAGAAATGGACGAGCAACAACAAGCTGACAATGGCGGCAAG
CATGGTAAGCGACGCCACAAAGGCAAACGACAATTAGACAGCAAAGCCGAGCCAGAGCCAGAGCCAGATGAACAA
GACCAAGACCAAGACCCCCAGCACCACAAATGGATCTTGCATCCCGGCATGTCAAAGTCGGATGCCAGAAGCTTC
ATCTTTCCCGAAATGCCTCGCCGCTCCCGCCATCTTCAGCAGCCTGCAGGCCCCATTCGCCTCGACCTGACGCAG
CCGACGCAGCAGCCCATTCTCCTTGCTCTTGGGGGAGTTGGCGGGCTGGGCAACCCGCACTTTGCCTCGCGCCAG
TCCCCGCACCCACTCTTTGCCACACGGGGAGACGAAGCCATGACGATGCGCCTAGAGCTCGAGCTCAAGCTGCTT
GCCGACGTGGGCCTCGTTGGCTTGCCCAATGCTGGCAAGAGCACCCTGTTGCGCGCTCTGACGCGCAGCCGCACG
CGTGTGGGCAGCTGGGCATTTACCACGCTGCAGCCAAACATTGGCACTGTTGTCCTCGACAAGTACTCGGGCCAT
CCCCCTGTGTCGAGGCCAAGCAGTGGGCGCAGCGACGAGGCGAATGCTGGGCCGCGCTCTCGCTTCAGCGTTGCC
GACATTCCAGGCCTGATTCAGGGCGCCCATCTGGACCGCGGCCTCGGCATCGCCTTTCTACGCCATGTTGAGCGC
GCTGCCGTCTTGGCCTTTGTCATTGACCTGTCTGCTGGCAACGCCGTCGACGCCCTCGCTGCCCTGTGGCACGAA
GTCGGGCTCTATGCGCAAATGCGCGACGAGCAGGAGCGCGCCCGCCTCCAACAAGAGGAGGAGGAGCAGGAGCAG
GAGCATGCCCAAAAGACTGATGCCGTGCTCCCCGTCAATCTGGCAATCACGGACGACGCTGCCGCGCCTTTGCAG
CCCGCCTCGGCCCTGCACATTGCCGGCAAGCCGTGGTGCGTCATTGCCACAAAGGCAGATTTACCAGACACGCAG
CAAAACTTTGCCCAGCTAAAGGCCCATCTTGATGACGTGACCAAGGGCCGCGCCGCACATCCTGCCAATGTCCAG
GGCGGCTGGACCACGAGTGTTGCCGCTATTCCCGTCAGTGCCATCAAGGGGCAAGGCATTGATCCCATTGTGCAC
TGGATCGCCGGCTTGCTCCACGCTTGA
Gene >OphauB2|1245
ATGGTTGCCCGGCCGTCGCTCTGCCGCCTGGCCATCTCTAGACGGTGTAGAGCTCCCCTCCTCCATCTCCCACGA
TGCCATCGCCGCCATTCGACGGTCAATGGCCTGCCCGAGTCGCACCTCAATCCGCGTCCCGACGACTACGCCGCC
GTCAACTTTGCCGACCGCGCCCAGCTGACGCTCTACGCCGGTCCTGGTGGCAGCGGGTGCGTATCCTTTCAGCGC
GAGGCCTATCTGCCCGATGGACCTCCAAATGGCGGTGATGGCGGCGCCGGCGGCAACATCTACATCCAGGCTGCT
CCGGGCGAGACATCGCTGCACAAGCTGGCGCGTCGCACCTTTGTTCGTGCAGGGCGTGGCAAGAGCGGCCAAGGG
AGTTCCCGGAATGGCGTCAAAGGCGAGGATGTCATTTTGACGGTGCCTGTGGGCACTGTGGTGCGTGAGATTTGG
CGCCACGACCCGGCCGTCCAAGAAGCTGCCCTGGTGCACGAGTGGCGCAAGGAGAAGAAGTTGAAGAAGCGCGAG
AAGCGGCTTGCTCAAGAGCGGGCAGAGGCGGAGAGGAAGCGAATGGAAGCAGAGGCGGCCGTCGAGCAACAATTG
CAGGAGCAGCAAGAAGCGGACAAGCGCCTGGACGAATTCGAGGACGAGGACGAGGTGGAGGACGAGGTGGAGGAC
GAGGTGGAGGAGCAGCAACAAGAGGCCGACCAAGAAGAAATGGACGAGCAACAACAAGCTGACAATGGCGGCAAG
CATGGTAAGCGACGCCACAAAGGCAAACGACAATTAGACAGCAAAGCCGAGCCAGAGCCAGAGCCAGATGAACAA
GACCAAGACCAAGACCCCCAGCACCACAAATGGATCTTGCATCCCGGCATGTCAAAGTCGGATGCCAGAAGCTTC
ATCTTTCCCGAAATGCCTCGCCGCTCCCGCCATCTTCAGCAGCCTGCAGGCCCCATTCGCCTCGACCTGACGCAG
CCGACGCAGCAGCCCATTCTCCTTGCTCTTGGGGGAGTTGGCGGGCTGGGCAACCCGCACTTTGCCTCGCGCCAG
TCCCCGCACCCACTCTTTGCCACACGGGGAGACGAAGCCATGACGATGCGCCTAGAGCTCGAGCTCAAGCTGCTT
GCCGACGTGGGCCTCGTTGGCTTGCCCAATGCTGGCAAGAGCACCCTGTTGCGCGCTCTGACGCGCAGCCGCACG
CGTGTGGGCAGCTGGGCATTTACCACGCTGCAGCCAAACATTGGCACTGTTGTCCTCGACAAGTACTCGGGCCAT
CCCCCTGTGTCGAGGCCAAGCAGTGGGCGCAGCGACGAGGCGAATGCTGGGCCGCGCTCTCGCTTCAGCGTTGCC
GACATTCCAGGCCTGATTCAGGGCGCCCATCTGGACCGCGGCCTCGGCATCGCCTTTCTACGCCATGTTGAGCGC
GCTGCCGTCTTGGCCTTTGTCATTGACCTGTCTGCTGGCAACGCCGTCGACGCCCTCGCTGCCCTGTGGCACGAA
GTCGGGCTCTATGCGCAAATGCGCGACGAGCAGGAGCGCGCCCGCCTCCAACAAGAGGAGGAGGAGCAGGAGCAG
GAGCATGCCCAAAAGACTGATGCCGTGCTCCCCGTCAATCTGGCAATCACGGACGACGCTGCCGCGCCTTTGCAG
CCCGCCTCGGCCCTGCACATTGCCGGCAAGCCGTGGTGCGTCATTGCCACAAAGGCAGATTTACCAGACACGCAG
CAAAACTTTGCCCAGCTAAAGGCCCATCTTGATGACGTGACCAAGGGCCGCGCCGCACATCCTGCCAATGTCCAG
GGCGGCTGGACCACGAGTGTTGCCGCTATTCCCGTCAGTGCCATCAAGGGGCAAGGCATTGATCCCATTGTGCAC
TGGATCGCCGGCTTGCTCCACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail