Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1233
Gene name
LocationContig_13:134937..135528
Strand-
Gene length (bp)591
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 1.5E-13 78 157

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 70 166 1.0E-11
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 70 166 5.0E-10
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 70 166 5.0E-10
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 69 164 2.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4284
Ophiocordyceps australis map64 (Brazil) OphauB2|1233 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02775
Ophiocordyceps kimflemingae Ophio5|2235
Ophiocordyceps subramaniannii Hirsu2|8674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1233
MSPKDPTEKHDDAALNGSAEEKVRAWLQLTRNHDGHLKAGDWMAALLPHMDVHFASAAMPHPSAVFTYVVQANHC
NRMGNLHGGAAASLFDFCTTLPLALVSRPGFWQFMGVSRSLNVTYLRPALCGEELLIECRIVQIGRRLTTLHGVM
KRKKDGQLLSMCEHGKVNNDPEPSI*
Coding >OphauB2|1233
ATGAGCCCCAAAGACCCGACTGAAAAGCACGACGACGCCGCTCTCAATGGCAGTGCCGAGGAAAAAGTCCGAGCA
TGGCTCCAACTCACGCGCAACCACGACGGCCACCTCAAAGCCGGAGACTGGATGGCTGCCCTTCTTCCGCACATG
GACGTCCACTTCGCATCAGCAGCCATGCCCCATCCCTCGGCCGTCTTCACCTATGTCGTTCAGGCCAATCACTGC
AACCGCATGGGCAACCTCCATGGCGGTGCTGCTGCATCGCTGTTTGACTTTTGCACCACGCTTCCCCTTGCCCTT
GTTTCCCGCCCGGGTTTCTGGCAATTCATGGGAGTGAGTCGCTCCCTCAACGTCACCTACCTGCGCCCTGCGCTC
TGTGGAGAAGAGCTTCTCATTGAATGCCGCATTGTGCAAATTGGGAGGCGTCTTACCACGTTGCACGGTGTCATG
AAGAGAAAGAAGGACGGCCAGCTTCTGTCCATGTGCGAGCATGGAAAAGTCAACAATGATCCAGAGCCCAGCATT
TAA
Transcript >OphauB2|1233
ATGAGCCCCAAAGACCCGACTGAAAAGCACGACGACGCCGCTCTCAATGGCAGTGCCGAGGAAAAAGTCCGAGCA
TGGCTCCAACTCACGCGCAACCACGACGGCCACCTCAAAGCCGGAGACTGGATGGCTGCCCTTCTTCCGCACATG
GACGTCCACTTCGCATCAGCAGCCATGCCCCATCCCTCGGCCGTCTTCACCTATGTCGTTCAGGCCAATCACTGC
AACCGCATGGGCAACCTCCATGGCGGTGCTGCTGCATCGCTGTTTGACTTTTGCACCACGCTTCCCCTTGCCCTT
GTTTCCCGCCCGGGTTTCTGGCAATTCATGGGAGTGAGTCGCTCCCTCAACGTCACCTACCTGCGCCCTGCGCTC
TGTGGAGAAGAGCTTCTCATTGAATGCCGCATTGTGCAAATTGGGAGGCGTCTTACCACGTTGCACGGTGTCATG
AAGAGAAAGAAGGACGGCCAGCTTCTGTCCATGTGCGAGCATGGAAAAGTCAACAATGATCCAGAGCCCAGCATT
TAA
Gene >OphauB2|1233
ATGAGCCCCAAAGACCCGACTGAAAAGCACGACGACGCCGCTCTCAATGGCAGTGCCGAGGAAAAAGTCCGAGCA
TGGCTCCAACTCACGCGCAACCACGACGGCCACCTCAAAGCCGGAGTCAGCTTGTTTCCTGCTCTCTCAATTTTT
GTTCCGCCTTCCACCGCTAACGTGTTTTGACAGGACTGGATGGCTGCCCTTCTTCCGCACATGGACGTCCACTTC
GCATCAGCAGCCATGCCCCATCCCTCGGCCGTCTTCACCTATGTCGTTCAGGCCAATCACTGCAACCGCATGGGC
AACCTCCATGGCGGTGCTGCTGCATCGCTGTTTGACTTTTGCACCACGCTTCCCCTTGCCCTTGTTTCCCGCCCG
GGTTTCTGGCAATTCATGGGAGTGAGTCGCTCCCTCAACGTCACCTACCTGCGCCCTGCGCTCTGTGGAGAAGAG
CTTCTCATTGAATGCCGCATTGTGCAAATTGGGAGGCGTCTTACCACGTTGCACGGTGTCATGAAGAGAAAGAAG
GACGGCCAGCTTCTGTCCATGTGCGAGCATGGAAAAGTCAACAATGATCCAGAGCCCAGCATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail