Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1230
Gene name
LocationContig_13:126316..128292
Strand+
Gene length (bp)1976
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 3 579 8.0E-119
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 4 552 5.0E-78
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 31 538 1.0E-69
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 27 568 3.0E-60
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 30 543 4.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 3 579 8.0E-119
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 4 552 5.0E-78
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 31 538 1.0E-69
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 27 568 3.0E-60
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 30 543 4.0E-56
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 19 566 2.0E-46
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 8 555 1.0E-42
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 81 555 2.0E-42
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 43 577 4.0E-42
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 81 555 6.0E-42
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 4 552 8.0E-40
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 29 556 4.0E-39
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 265 487 1.0E-08
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 30 517 2.0E-07
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 267 537 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 94 116 22
3 128 145 17
4 150 172 22
5 184 206 22
6 216 238 22
7 264 286 22
8 296 318 22
9 338 360 22
10 375 397 22
11 402 424 22
12 439 461 22
13 468 490 22
14 545 564 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1230
MAVSSSTEADNATHTANLSEKSAAALGAHDVSDSDGESIKQDGVRQVEAVTQVWPKSVMYTVFVLLYLVEFTVFL
FGYVTSNLEAYITSSFKNHGLLALTRIVAGIVAGAVKLGIAKYINIRGRCEGFIVMTSFLVFGIIIKAFSKNIST
YAAGNTIYSVGSSGMYYIIEVVLADMTTLPNRMIVYGIWMSPRIAATFGGPQIAQLYNKNSSFGWAFGTFAIIIS
ALAFPVAVIFIFYERKARKLAVLETAKEKRPLVQTIKYYLVEFDVVGTLLLILGLCLFVLPTNLAKMAPKGWATP
YIIATMLLGIIFFASFVMWEKFGAKVPFIPFAKMKDRTIMGACLLDLFVFISVFSWDTYYFSYLIVVHGLSISMA
GYTLNAYSITSTIMAPFVGLGLRFYGRYYWVAVAGLPFCILGTVLLIHFRQPGVHIAYLVMCQVFHGISGGLWAM
AAPLALMSSVSHQDVAAVIALKSMFCSIGAALGFAIAGALWTNNLPGEIEKALPDDAKGQAAELYASIKTQTAHP
LGHVIRDAVVEAYGIVQRRMVIAGCAFLPFIVACVVIWHNRPVPKRAQTKGNVL*
Coding >OphauB2|1230
ATGGCTGTCTCAAGCAGCACCGAGGCCGATAATGCCACCCACACGGCCAACTTGAGTGAAAAGAGCGCGGCGGCG
TTGGGGGCGCACGACGTCAGCGACTCGGACGGCGAGTCCATCAAGCAAGATGGCGTTCGACAGGTCGAGGCCGTG
ACGCAGGTCTGGCCCAAGTCTGTCATGTACACCGTCTTTGTCCTGCTCTATCTCGTCGAGTTTACCGTCTTTCTC
TTTGGCTACGTCACGTCAAATCTCGAGGCCTACATCACATCGTCCTTTAAGAACCACGGCCTCTTGGCCCTGACC
CGCATCGTGGCCGGCATTGTGGCCGGCGCCGTTAAGCTCGGCATAGCAAAGTACATCAACATCCGCGGCCGCTGC
GAGGGCTTTATTGTAATGACGTCGTTTCTCGTCTTTGGCATCATCATCAAGGCCTTTTCCAAAAACATTTCCACC
TATGCGGCTGGCAACACCATCTATAGCGTTGGCAGTAGCGGCATGTACTACATCATTGAGGTTGTGCTCGCCGAC
ATGACGACGCTGCCCAACCGAATGATTGTCTATGGCATCTGGATGAGTCCACGCATTGCCGCCACCTTTGGCGGG
CCTCAGATTGCTCAGCTGTATAACAAGAACTCGTCGTTTGGCTGGGCCTTTGGCACCTTTGCCATCATCATTAGT
GCCCTGGCTTTCCCGGTTGCTGTCATCTTCATCTTCTATGAGCGCAAGGCCAGGAAGCTGGCCGTGCTCGAGACT
GCAAAAGAAAAGAGGCCGCTGGTGCAAACCATCAAGTATTACTTGGTCGAGTTTGATGTGGTTGGCACGCTGTTG
CTCATTCTGGGCCTCTGTCTCTTTGTCCTGCCGACCAACCTGGCCAAAATGGCGCCCAAGGGCTGGGCGACGCCC
TACATCATTGCCACCATGTTGCTGGGCATCATCTTCTTCGCCAGCTTTGTCATGTGGGAAAAGTTTGGCGCCAAG
GTTCCCTTCATCCCCTTTGCCAAGATGAAGGACAGGACCATTATGGGGGCCTGTCTGCTCGATCTCTTCGTCTTC
ATTTCCGTCTTCTCGTGGGACACCTACTACTTTTCGTACCTTATTGTGGTGCATGGCCTCAGCATCTCCATGGCG
GGATACACTCTCAATGCCTATTCCATCACATCAACCATCATGGCGCCTTTTGTTGGACTGGGCCTGCGCTTCTAT
GGGCGCTACTACTGGGTGGCAGTGGCCGGTCTGCCGTTTTGCATTTTGGGCACCGTCTTGCTCATCCACTTCCGG
CAGCCTGGCGTCCACATTGCCTATCTCGTCATGTGCCAGGTCTTCCACGGCATCTCGGGAGGTCTCTGGGCCATG
GCGGCGCCGCTGGCTCTCATGAGCTCCGTGTCACACCAGGACGTGGCTGCCGTCATTGCCCTCAAGAGCATGTTT
TGCTCGATTGGGGCGGCGCTCGGGTTTGCCATTGCAGGAGCGCTGTGGACCAACAATCTGCCTGGCGAGATTGAA
AAGGCATTACCCGACGATGCCAAGGGCCAGGCGGCGGAGCTGTATGCCAGCATCAAGACGCAGACGGCGCACCCG
CTAGGACATGTTATCCGCGATGCTGTTGTCGAGGCATACGGCATTGTGCAGCGACGCATGGTGATTGCGGGCTGT
GCCTTTTTGCCCTTTATCGTGGCCTGCGTTGTCATTTGGCACAACCGCCCAGTGCCCAAGAGGGCGCAGACCAAG
GGCAACGTCTTGTAG
Transcript >OphauB2|1230
ATGGCTGTCTCAAGCAGCACCGAGGCCGATAATGCCACCCACACGGCCAACTTGAGTGAAAAGAGCGCGGCGGCG
TTGGGGGCGCACGACGTCAGCGACTCGGACGGCGAGTCCATCAAGCAAGATGGCGTTCGACAGGTCGAGGCCGTG
ACGCAGGTCTGGCCCAAGTCTGTCATGTACACCGTCTTTGTCCTGCTCTATCTCGTCGAGTTTACCGTCTTTCTC
TTTGGCTACGTCACGTCAAATCTCGAGGCCTACATCACATCGTCCTTTAAGAACCACGGCCTCTTGGCCCTGACC
CGCATCGTGGCCGGCATTGTGGCCGGCGCCGTTAAGCTCGGCATAGCAAAGTACATCAACATCCGCGGCCGCTGC
GAGGGCTTTATTGTAATGACGTCGTTTCTCGTCTTTGGCATCATCATCAAGGCCTTTTCCAAAAACATTTCCACC
TATGCGGCTGGCAACACCATCTATAGCGTTGGCAGTAGCGGCATGTACTACATCATTGAGGTTGTGCTCGCCGAC
ATGACGACGCTGCCCAACCGAATGATTGTCTATGGCATCTGGATGAGTCCACGCATTGCCGCCACCTTTGGCGGG
CCTCAGATTGCTCAGCTGTATAACAAGAACTCGTCGTTTGGCTGGGCCTTTGGCACCTTTGCCATCATCATTAGT
GCCCTGGCTTTCCCGGTTGCTGTCATCTTCATCTTCTATGAGCGCAAGGCCAGGAAGCTGGCCGTGCTCGAGACT
GCAAAAGAAAAGAGGCCGCTGGTGCAAACCATCAAGTATTACTTGGTCGAGTTTGATGTGGTTGGCACGCTGTTG
CTCATTCTGGGCCTCTGTCTCTTTGTCCTGCCGACCAACCTGGCCAAAATGGCGCCCAAGGGCTGGGCGACGCCC
TACATCATTGCCACCATGTTGCTGGGCATCATCTTCTTCGCCAGCTTTGTCATGTGGGAAAAGTTTGGCGCCAAG
GTTCCCTTCATCCCCTTTGCCAAGATGAAGGACAGGACCATTATGGGGGCCTGTCTGCTCGATCTCTTCGTCTTC
ATTTCCGTCTTCTCGTGGGACACCTACTACTTTTCGTACCTTATTGTGGTGCATGGCCTCAGCATCTCCATGGCG
GGATACACTCTCAATGCCTATTCCATCACATCAACCATCATGGCGCCTTTTGTTGGACTGGGCCTGCGCTTCTAT
GGGCGCTACTACTGGGTGGCAGTGGCCGGTCTGCCGTTTTGCATTTTGGGCACCGTCTTGCTCATCCACTTCCGG
CAGCCTGGCGTCCACATTGCCTATCTCGTCATGTGCCAGGTCTTCCACGGCATCTCGGGAGGTCTCTGGGCCATG
GCGGCGCCGCTGGCTCTCATGAGCTCCGTGTCACACCAGGACGTGGCTGCCGTCATTGCCCTCAAGAGCATGTTT
TGCTCGATTGGGGCGGCGCTCGGGTTTGCCATTGCAGGAGCGCTGTGGACCAACAATCTGCCTGGCGAGATTGAA
AAGGCATTACCCGACGATGCCAAGGGCCAGGCGGCGGAGCTGTATGCCAGCATCAAGACGCAGACGGCGCACCCG
CTAGGACATGTTATCCGCGATGCTGTTGTCGAGGCATACGGCATTGTGCAGCGACGCATGGTGATTGCGGGCTGT
GCCTTTTTGCCCTTTATCGTGGCCTGCGTTGTCATTTGGCACAACCGCCCAGTGCCCAAGAGGGCGCAGACCAAG
GGCAACGTCTTGTAG
Gene >OphauB2|1230
ATGGCTGTCTCAAGCAGCACCGAGGCCGATAATGCCACCCACACGGCCAACTTGAGTGAAAAGAGCGCGGCGGCG
TTGGGGGCGCACGACGTCAGCGACTCGGACGGCGAGTCCATCAAGCAAGATGGCGTTCGACAGGTCGAGGCCGTG
ACGCAGGTCTGGCCCAAGTCTGTCATGTACACCGTCTTTGTCCTGTACGTCTCCAGCGTCTCTGGCGTGCGGCAG
CTCTGCTTGCAGGACCTGGCTGATGAGTTCAAAGGCTCTATCTCGTCGAGTTTACCGTCTTTCTCTTTGGCTACG
TCACGTCAAATCTCGAGGCCTACATCACATCGTCCTTTAAGAACCACGGCCTCTTGGCCCTGACCCGCATCGTGG
CCGGCATTGTGGCCGGCGCCGTTAAGCTCGGCATAGCAAAGTACATCAACATCCGCGGCCGCTGCGAGGGCTTTA
TTGTAATGACGTCGTTTCTCGTCTTTGGCATCATCATCAAGGCCTTTTCCAAAAACATTTCCACCTATGCGGCTG
GCAACACCATCTATAGCGTTGGCAGTAGCGGCATGTACTACATCATTGAGGTTGTGCTCGCCGACATGACGACGC
TGCCCAACCGAATGATTGTCTATGGCATCTGGATGAGTCCACGCATTGCCGCCACCTTTGGCGGGCCTCAGATTG
CTCAGCTGTATAACAAGAACTCGTCGTTTGGCTGGGCCTTTGGCACCTTTGCCATCATCATTAGTGCCCTGGCTT
TCCCGGTTGCTGTCATCTTCATCTTCTATGAGCGCAAGGCCAGGAAGCTGGCCGTGCTCGAGACTGCAAAAGAAA
AGAGGCCGCTGGTGCAAACCATCAAGTATTACTTGGTCGAGTTTGATGGTAAGTCGCTGCCATGCAAACGAGCAT
GCCCAGGCTAACCCATTGCCAGTGGTTGGCACGCTGTTGCTCATTCTGGGCCTCTGTCTCTTTGTCCTGCCGACC
AACCTGGCCAAAATGGCGCCCAAGGGCTGGGCGACGCCCTACATCATTGCCACCATGTTGCTGGGCATCATCTTC
TTCGCCAGCTTTGTCATGTGGGAAAAGTTTGGCGCCAAGGTTCCCTTCATCCCCTTTGCCAAGATGAAGGACAGG
ACCATTATGGGGGCCTGTCTGCTCGATCTCTTCGTCTTCATTTCCGTCTTGTAAGTCGCGCCTCCAAGTGCAGGG
TTGTGGGAGCAGGGCAGCAAGCAGGCTGACGACAACAACAGCTCGTGGGACACCTACTACTTTTCGTACCTTATT
GTGGTGCATGGCCTCAGCATCTCCATGGCGGGATACACTCTCAATGCCTATTCCATCACATCAACCATCATGGCG
CCTTTTGTTGGACTGTAAGTCGTGGTTGCTGGCTGCATGGTGAGCAGAATCTAACACGCTTGGCGTGCAGGGGCC
TGCGCTTCTATGGGCGCTACTACTGGGTGGCAGTGGCCGGTCTGCCGTTTTGCATTTTGGGCACCGTCTTGCTCA
TCCACTTCCGGCAGCCTGGCGTCCACATTGCCTATCTCGTCATGTGCCAGGTCTTCCACGGCATCTCGGGAGGTC
TCTGGGCCATGGCGGCGCCGCTGGCTCTCATGAGCTCCGTGTCACACCAGGACGTGGCTGCCGTCATTGCCCTCA
AGAGCATGTTTTGCTCGATTGGGGCGGCGCTCGGGTTTGCCATTGCAGGAGCGCTGTGGACCAACAATCTGCCTG
GCGAGATTGAAAAGGCATTACCCGACGATGCCAAGGGCCAGGCGGCGGAGCTGTATGCCAGCATCAAGACGCAGA
CGGCGCACCCGCTAGGACATGTTATCCGCGATGCTGTTGTCGAGGCATACGGCATTGTGCAGCGACGCATGGTGA
TTGCGGGCTGTGCCTTTTTGCCCTTTATCGTGGCCTGCGTTGTCATTTGGCACAACCGCCCAGTGCCCAAGAGGG
CGCAGACCAAGGGCAACGTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail