Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1225
Gene name
LocationContig_13:116353..117295
Strand-
Gene length (bp)942
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.2E-23 23 229
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.3E-10 32 230
PF08659 KR KR domain 3.4E-07 25 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 15 303 3.0E-48
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 22 302 1.0E-43
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 1 308 2.0E-41
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 22 300 2.0E-36
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 19 299 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 15 303 3.0E-48
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 22 302 1.0E-43
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 1 308 2.0E-41
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 22 300 2.0E-36
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 19 299 2.0E-36
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 20 304 1.0E-34
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 20 304 2.0E-33
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 20 300 2.0E-32
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 20 300 2.0E-32
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 20 300 3.0E-32
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 19 299 8.0E-32
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 20 300 6.0E-31
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 16 303 3.0E-30
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 17 303 1.0E-28
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 9 300 2.0E-28
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 20 313 1.0E-27
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 13 306 1.0E-26
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 9 300 2.0E-26
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 20 303 2.0E-26
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 20 304 1.0E-25
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 20 303 1.0E-25
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 20 303 2.0E-25
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 14 299 5.0E-21
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 10 225 1.0E-19
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 10 221 2.0E-18
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 20 276 3.0E-18
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 12 300 5.0E-18
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 12 300 5.0E-18
sp|Q62904|DHB7_RAT 3-keto-steroid reductase OS=Rattus norvegicus GN=Hsd17b7 PE=1 SV=1 23 263 1.0E-16
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 20 227 2.0E-16
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 26 228 2.0E-15
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 25 303 1.0E-14
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 19 225 1.0E-14
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 19 303 2.0E-14
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 20 227 2.0E-14
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 10 300 3.0E-14
sp|O88736|DHB7_MOUSE 3-keto-steroid reductase OS=Mus musculus GN=Hsd17b7 PE=1 SV=1 23 263 3.0E-14
sp|Q7XKF3|PORA_ORYSJ Protochlorophyllide reductase A, chloroplastic OS=Oryza sativa subsp. japonica GN=PORA PE=2 SV=1 19 303 5.0E-14
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 19 228 7.0E-14
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 22 229 2.0E-13
sp|Q41249|PORA_CUCSA Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1 19 225 4.0E-13
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 10 303 2.0E-12
sp|P56937|DHB7_HUMAN 3-keto-steroid reductase OS=Homo sapiens GN=HSD17B7 PE=1 SV=1 23 299 2.0E-12
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 20 227 4.0E-12
sp|P13653|PORA_HORVU Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1 19 303 2.0E-11
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 19 225 3.0E-11
sp|Q41578|PORA_WHEAT Protochlorophyllide reductase A, chloroplastic OS=Triticum aestivum GN=PORA PE=3 SV=1 19 303 4.0E-11
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 19 225 1.0E-10
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 10 227 2.0E-09
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 23 225 3.0E-09
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 19 226 3.0E-09
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 23 225 3.0E-09
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 10 227 6.0E-09
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 20 183 6.0E-09
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 20 227 7.0E-09
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 11 228 2.0E-08
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 11 228 2.0E-08
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 20 227 2.0E-08
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 10 166 8.0E-08
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 11 228 8.0E-08
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 23 227 8.0E-08
sp|Q59987|POR_SYNY3 Light-dependent protochlorophyllide reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=por PE=3 SV=2 25 238 1.0E-07
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 19 228 2.0E-07
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 22 231 3.0E-07
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 20 146 3.0E-07
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 23 227 4.0E-07
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 7 227 4.0E-07
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 23 146 6.0E-07
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 15 225 1.0E-06
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 20 170 1.0E-06
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 18 227 1.0E-06
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 20 170 1.0E-06
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 14 227 1.0E-06
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 20 170 1.0E-06
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 19 221 2.0E-06
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 14 227 2.0E-06
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 24 262 2.0E-06
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 20 227 2.0E-06
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 19 230 3.0E-06
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 19 230 3.0E-06
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 13 233 3.0E-06
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 20 242 3.0E-06
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 20 225 4.0E-06
sp|O66148|POR_LEPBY Light-dependent protochlorophyllide reductase OS=Leptolyngbya boryana GN=por PE=3 SV=2 25 135 5.0E-06
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 23 225 5.0E-06
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 2 227 5.0E-06
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 19 228 5.0E-06
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 23 146 6.0E-06
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 20 193 7.0E-06
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 19 250 7.0E-06
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 24 262 8.0E-06
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 15 223 9.0E-06
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 15 223 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1225
MFLFGNKGVEFSPEKDIPSLKGKVIVVTGGSNGLGKQAILEYARHEPKQIWLAARDTTKAKAALDEIKQQVPNAS
IKTVQLDLASLDSVATAAKTVLAESDRLDILMLNAGIMATSPDLTKDGYEMQFGTNHMGHALLTKLLLPLLDKTA
KSGADVRVAVLSSKAHGMAPKQGIVFDSLKTKASEMGAMQRYGQSKFANMLFARQLAKERPSLTVAAIHPGVVTT
NLLAGSTALWEPVRWGVALLAYTPFLVTVETGVKGQLWATVSKDVQSGEYYEPIGVGDTAIALGKDDDLAKKLWD
WTETELDAYISRK*
Coding >OphauB2|1225
ATGTTCTTGTTTGGAAACAAAGGGGTGGAGTTCTCACCCGAAAAAGACATTCCCTCGCTCAAAGGCAAGGTGATA
GTCGTTACGGGAGGGAGCAATGGCCTCGGCAAGCAAGCCATTCTCGAGTATGCTCGCCATGAGCCAAAGCAGATT
TGGTTGGCCGCCCGCGACACCACAAAGGCCAAGGCAGCCCTCGACGAAATCAAGCAACAAGTGCCCAATGCATCC
ATCAAGACGGTCCAGCTAGATCTCGCCTCCTTGGACTCTGTCGCTACGGCAGCCAAGACTGTCCTTGCCGAGTCA
GATCGCCTCGATATCCTCATGCTCAATGCCGGCATCATGGCCACTTCGCCCGACCTGACCAAGGATGGCTACGAG
ATGCAGTTTGGCACCAACCACATGGGCCACGCCCTCTTGACCAAGCTGCTGCTCCCGCTGCTCGACAAGACTGCC
AAGAGCGGCGCCGACGTGCGCGTCGCCGTCCTCTCGTCAAAGGCGCATGGCATGGCCCCCAAACAGGGCATCGTC
TTTGACTCGCTCAAGACAAAGGCAAGCGAGATGGGTGCCATGCAGCGCTACGGCCAGAGCAAGTTTGCCAATATG
CTTTTTGCCCGACAGCTGGCAAAAGAGCGCCCCAGCCTGACCGTTGCTGCCATCCACCCCGGCGTCGTCACCACA
AATCTCTTGGCAGGATCGACGGCTCTTTGGGAGCCTGTACGCTGGGGGGTGGCCTTGCTCGCATACACCCCCTTC
CTGGTAACAGTAGAGACTGGCGTCAAGGGCCAGCTATGGGCCACCGTGTCCAAGGACGTCCAGAGCGGAGAGTAC
TATGAGCCCATTGGCGTTGGCGACACTGCGATAGCGCTGGGAAAGGACGACGACCTGGCCAAGAAGCTGTGGGAC
TGGACTGAGACGGAATTGGATGCCTATATTAGCCGCAAGTAG
Transcript >OphauB2|1225
ATGTTCTTGTTTGGAAACAAAGGGGTGGAGTTCTCACCCGAAAAAGACATTCCCTCGCTCAAAGGCAAGGTGATA
GTCGTTACGGGAGGGAGCAATGGCCTCGGCAAGCAAGCCATTCTCGAGTATGCTCGCCATGAGCCAAAGCAGATT
TGGTTGGCCGCCCGCGACACCACAAAGGCCAAGGCAGCCCTCGACGAAATCAAGCAACAAGTGCCCAATGCATCC
ATCAAGACGGTCCAGCTAGATCTCGCCTCCTTGGACTCTGTCGCTACGGCAGCCAAGACTGTCCTTGCCGAGTCA
GATCGCCTCGATATCCTCATGCTCAATGCCGGCATCATGGCCACTTCGCCCGACCTGACCAAGGATGGCTACGAG
ATGCAGTTTGGCACCAACCACATGGGCCACGCCCTCTTGACCAAGCTGCTGCTCCCGCTGCTCGACAAGACTGCC
AAGAGCGGCGCCGACGTGCGCGTCGCCGTCCTCTCGTCAAAGGCGCATGGCATGGCCCCCAAACAGGGCATCGTC
TTTGACTCGCTCAAGACAAAGGCAAGCGAGATGGGTGCCATGCAGCGCTACGGCCAGAGCAAGTTTGCCAATATG
CTTTTTGCCCGACAGCTGGCAAAAGAGCGCCCCAGCCTGACCGTTGCTGCCATCCACCCCGGCGTCGTCACCACA
AATCTCTTGGCAGGATCGACGGCTCTTTGGGAGCCTGTACGCTGGGGGGTGGCCTTGCTCGCATACACCCCCTTC
CTGGTAACAGTAGAGACTGGCGTCAAGGGCCAGCTATGGGCCACCGTGTCCAAGGACGTCCAGAGCGGAGAGTAC
TATGAGCCCATTGGCGTTGGCGACACTGCGATAGCGCTGGGAAAGGACGACGACCTGGCCAAGAAGCTGTGGGAC
TGGACTGAGACGGAATTGGATGCCTATATTAGCCGCAAGTAG
Gene >OphauB2|1225
ATGTTCTTGTTTGGAAACAAAGGGGTGGAGTTCTCACCCGAAAAAGACATTCCCTCGCTCAAAGGCAAGGTGATA
GTCGTTACGGGAGGGAGCAATGGCCTCGGCAAGCAAGCCATTCTCGAGTATGCTCGCCATGAGCCAAAGCAGATT
TGGTTGGCCGCCCGCGACACCACAAAGGCCAAGGCAGCCCTCGACGAAATCAAGCAACAAGTGCCCAATGCATCC
ATCAAGACGGTCCAGCTAGATCTCGCCTCCTTGGACTCTGTCGCTACGGCAGCCAAGACTGTCCTTGCCGAGTCA
GATCGCCTCGATATCCTCATGCTCAATGCCGGCATCATGGCCACTTCGCCCGACCTGACCAAGGATGGCTACGAG
ATGCAGTTTGGCACCAACCACATGGGCCACGCCCTCTTGACCAAGCTGCTGCTCCCGCTGCTCGACAAGACTGCC
AAGAGCGGCGCCGACGTGCGCGTCGCCGTCCTCTCGTCAAAGGCGCATGGCATGGCCCCCAAACAGGGCATCGTC
TTTGACTCGCTCAAGACAAAGGCAAGCGAGATGGGTGCCATGCAGCGCTACGGCCAGAGCAAGTTTGCCAATATG
CTTTTTGCCCGACAGCTGGCAAAAGAGCGCCCCAGCCTGACCGTTGCTGCCATCCACCCCGGCGTCGTCACCACA
AATCTCTTGGCAGGATCGACGGCTCTTTGGGAGCCTGTACGCTGGGGGGTGGCCTTGCTCGCATACACCCCCTTC
CTGGTAACAGTAGAGACTGGCGTCAAGGGCCAGCTATGGGCCACCGTGTCCAAGGACGTCCAGAGCGGAGAGTAC
TATGAGCCCATTGGCGTTGGCGACACTGCGATAGCGCTGGGAAAGGACGACGACCTGGCCAAGAAGCTGTGGGAC
TGGACTGAGACGGAATTGGATGCCTATATTAGCCGCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail