Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1222
Gene name
LocationContig_13:108970..111727
Strand-
Gene length (bp)2757
Transcript length (bp)2700
Coding sequence length (bp)2700
Protein length (aa) 900

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 8.9E-46 106 270
PF00271 Helicase_C Helicase conserved C-terminal domain 6.9E-24 357 452
PF08147 DBP10CT DBP10CT (NUC160) domain 2.0E-19 732 799
PF04851 ResIII Type III restriction enzyme, res subunit 4.9E-06 126 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 1 898 0.0E+00
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 1 898 0.0E+00
sp|A4R5B8|DBP10_MAGO7 ATP-dependent RNA helicase DBP10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP10 PE=3 SV=1 1 898 0.0E+00
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 1 898 0.0E+00
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 1 898 0.0E+00
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 1 898 0.0E+00
sp|A4R5B8|DBP10_MAGO7 ATP-dependent RNA helicase DBP10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP10 PE=3 SV=1 1 898 0.0E+00
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 1 898 0.0E+00
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 57 898 0.0E+00
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 1 898 0.0E+00
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 1 898 0.0E+00
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 49 899 0.0E+00
sp|Q0UMB6|DBP10_PHANO ATP-dependent RNA helicase DBP10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP10 PE=3 SV=1 1 898 0.0E+00
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 79 896 0.0E+00
sp|Q6BL34|DBP10_DEBHA ATP-dependent RNA helicase DBP10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP10 PE=3 SV=2 55 898 0.0E+00
sp|Q6FNA2|DBP10_CANGA ATP-dependent RNA helicase DBP10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP10 PE=3 SV=1 70 898 0.0E+00
sp|A3LZT3|DBP10_PICST ATP-dependent RNA helicase DBP10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP10 PE=3 SV=2 65 898 0.0E+00
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 1 467 0.0E+00
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 45 898 0.0E+00
sp|Q12389|DBP10_YEAST ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP10 PE=1 SV=2 39 898 0.0E+00
sp|A6ZXU0|DBP10_YEAS7 ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP10 PE=3 SV=1 39 898 0.0E+00
sp|Q757U8|DBP10_ASHGO ATP-dependent RNA helicase DBP10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP10 PE=3 SV=1 48 898 0.0E+00
sp|Q6CIR0|DBP10_KLULA ATP-dependent RNA helicase DBP10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP10 PE=3 SV=1 46 898 0.0E+00
sp|A7TGW7|DBP10_VANPO ATP-dependent RNA helicase DBP10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP10 PE=3 SV=1 70 898 0.0E+00
sp|A5DZT7|DBP10_LODEL ATP-dependent RNA helicase DBP10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP10 PE=3 SV=1 80 898 0.0E+00
sp|Q5ANB2|DBP10_CANAL ATP-dependent RNA helicase DBP10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP10 PE=3 SV=1 80 898 0.0E+00
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 79 804 3.0E-173
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 82 616 6.0E-163
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 79 617 4.0E-162
sp|Q4P3W3|DBP10_USTMA ATP-dependent RNA helicase DBP10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP10 PE=3 SV=1 84 555 8.0E-157
sp|P0CR06|DBP10_CRYNJ ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP10 PE=3 SV=1 73 820 6.0E-155
sp|P0CR07|DBP10_CRYNB ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP10 PE=3 SV=1 73 820 6.0E-155
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 84 802 7.0E-149
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 80 810 2.0E-145
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 80 810 3.0E-145
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 84 465 7.0E-77
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 74 465 4.0E-75
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 84 472 1.0E-73
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 84 510 6.0E-73
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 80 510 1.0E-72
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 80 480 2.0E-72
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 57 465 4.0E-72
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 84 480 5.0E-72
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 84 469 9.0E-72
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 82 465 4.0E-71
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 73 465 1.0E-70
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 62 460 1.0E-70
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 84 465 3.0E-70
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 84 480 3.0E-70
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 84 480 3.0E-70
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 84 465 4.0E-70
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 84 465 5.0E-70
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 84 469 7.0E-70
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 84 469 7.0E-70
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 84 465 7.0E-70
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 84 465 7.0E-70
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 84 497 8.0E-70
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 84 465 1.0E-69
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 84 480 3.0E-69
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 84 461 6.0E-69
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 84 461 7.0E-69
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 84 508 8.0E-69
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 84 499 9.0E-69
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 84 505 1.0E-68
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 84 506 1.0E-68
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 84 465 3.0E-68
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 77 480 5.0E-68
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 84 497 6.0E-68
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 84 461 7.0E-68
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 84 469 7.0E-68
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 84 480 7.0E-68
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 84 497 1.0E-67
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 79 465 1.0E-67
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 84 480 2.0E-67
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 84 465 2.0E-67
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 93 480 1.0E-66
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 84 461 1.0E-66
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 84 480 2.0E-66
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 84 534 2.0E-66
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 84 480 4.0E-66
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 84 525 6.0E-66
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 84 480 6.0E-66
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 84 469 7.0E-66
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 84 469 7.0E-66
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 84 461 8.0E-66
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 84 469 9.0E-66
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 84 480 9.0E-66
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 84 480 1.0E-65
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 84 480 1.0E-65
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 84 480 1.0E-65
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 84 461 2.0E-65
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 84 461 2.0E-65
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 84 465 3.0E-65
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 81 469 4.0E-65
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 84 461 5.0E-65
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 84 461 6.0E-65
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 84 480 6.0E-65
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 32 461 7.0E-65
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 84 480 7.0E-65
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 84 480 7.0E-65
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 84 480 8.0E-65
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 84 461 8.0E-65
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 84 480 8.0E-65
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 84 480 8.0E-65
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 84 480 8.0E-65
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 84 480 8.0E-65
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 84 480 8.0E-65
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 84 480 8.0E-65
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 84 480 8.0E-65
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 84 480 8.0E-65
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 84 461 1.0E-64
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 74 461 1.0E-64
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 80 461 2.0E-64
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 84 461 2.0E-64
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 84 480 2.0E-64
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 89 478 2.0E-64
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 84 480 2.0E-64
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 83 473 5.0E-64
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 84 480 6.0E-64
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 83 473 6.0E-64
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 84 499 7.0E-64
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 84 497 1.0E-63
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 84 469 1.0E-63
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 84 469 2.0E-63
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 84 469 2.0E-63
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 84 461 2.0E-63
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 83 461 4.0E-63
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 89 476 4.0E-63
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 84 497 5.0E-63
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 82 469 6.0E-63
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 84 480 7.0E-63
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 84 477 1.0E-62
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 84 482 1.0E-62
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 80 461 1.0E-62
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 78 482 3.0E-62
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 84 465 3.0E-61
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 84 472 4.0E-61
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 84 461 4.0E-61
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 84 461 5.0E-61
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 84 461 5.0E-61
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 84 461 5.0E-61
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 84 461 6.0E-61
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 73 472 9.0E-61
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 84 461 1.0E-60
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 82 466 2.0E-60
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 84 476 2.0E-60
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 84 463 1.0E-59
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 84 469 3.0E-59
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 50 466 3.0E-59
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 84 463 4.0E-59
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 73 472 4.0E-59
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 73 472 4.0E-59
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 84 463 4.0E-59
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 84 463 4.0E-59
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 84 463 4.0E-59
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 84 461 5.0E-59
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 73 472 5.0E-59
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 93 461 6.0E-59
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 84 476 7.0E-59
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 79 472 7.0E-59
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 84 476 7.0E-59
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 84 463 8.0E-59
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 84 472 9.0E-59
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 84 476 9.0E-59
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 84 476 1.0E-58
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 84 461 1.0E-58
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 73 472 1.0E-58
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 84 463 2.0E-58
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 83 478 2.0E-58
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 84 463 2.0E-58
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 79 472 2.0E-58
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 83 465 3.0E-58
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 79 472 4.0E-58
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 84 461 4.0E-58
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 83 480 7.0E-58
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 102 460 8.0E-58
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 82 455 8.0E-58
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 84 472 9.0E-58
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 89 473 1.0E-57
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 714 898 2.0E-57
sp|Q4PEX7|DBP8_USTMA ATP-dependent RNA helicase DBP8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP8 PE=3 SV=2 80 471 2.0E-57
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 84 493 2.0E-57
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 84 480 4.0E-57
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 83 460 4.0E-57
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 84 478 6.0E-57
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 59 472 9.0E-57
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 89 473 1.0E-56
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 79 472 1.0E-56
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 102 465 1.0E-56
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 84 477 2.0E-56
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 84 495 3.0E-56
sp|Q0UN57|PRP5_PHANO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP5 PE=3 SV=2 87 463 4.0E-56
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 84 467 4.0E-56
sp|A8G828|RHLB_SERP5 ATP-dependent RNA helicase RhlB OS=Serratia proteamaculans (strain 568) GN=rhlB PE=3 SV=1 84 493 5.0E-56
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 68 461 6.0E-56
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 82 461 7.0E-56
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 84 473 7.0E-56
sp|A5UI36|RHLB_HAEIG ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittGG) GN=rhlB PE=3 SV=1 84 460 7.0E-56
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 84 460 7.0E-56
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 59 472 8.0E-56
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 72 460 9.0E-56
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 62 460 9.0E-56
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 63 472 1.0E-55
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 84 509 1.0E-55
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 84 461 1.0E-55
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 84 548 1.0E-55
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 88 478 2.0E-55
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 84 460 2.0E-55
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 84 525 2.0E-55
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 79 540 2.0E-55
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 39 473 2.0E-55
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 84 467 2.0E-55
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 84 461 2.0E-55
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 84 461 2.0E-55
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 88 478 2.0E-55
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 83 478 3.0E-55
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 96 461 3.0E-55
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 84 489 3.0E-55
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 84 461 3.0E-55
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 87 461 3.0E-55
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 84 472 4.0E-55
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 84 460 4.0E-55
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 62 460 4.0E-55
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 84 460 4.0E-55
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 84 525 4.0E-55
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 84 525 4.0E-55
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 84 460 5.0E-55
sp|Q2NQB2|RHLB_SODGM ATP-dependent RNA helicase RhlB OS=Sodalis glossinidius (strain morsitans) GN=rhlB PE=3 SV=1 84 493 5.0E-55
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 84 472 5.0E-55
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 87 455 5.0E-55
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 88 481 6.0E-55
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 84 467 7.0E-55
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 84 461 7.0E-55
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 84 460 8.0E-55
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 102 465 8.0E-55
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 84 455 9.0E-55
sp|B2VG58|RHLB_ERWT9 ATP-dependent RNA helicase RhlB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rhlB PE=3 SV=1 84 493 9.0E-55
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 84 460 9.0E-55
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 84 489 9.0E-55
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 84 463 1.0E-54
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 84 489 1.0E-54
sp|B1JQ11|RHLB_YERPY ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|Q66G19|RHLB_YERPS ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|A4TRC8|RHLB_YERPP ATP-dependent RNA helicase RhlB OS=Yersinia pestis (strain Pestoides F) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|Q1CNK3|RHLB_YERPN ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|Q8ZAD8|RHLB_YERPE ATP-dependent RNA helicase RhlB OS=Yersinia pestis GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|B2K046|RHLB_YERPB ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|Q1CBQ4|RHLB_YERPA ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|A7FD47|RHLB_YERP3 ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rhlB PE=3 SV=1 84 460 1.0E-54
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 84 493 1.0E-54
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 89 469 1.0E-54
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 84 460 1.0E-54
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 84 480 1.0E-54
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 84 489 2.0E-54
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 84 487 2.0E-54
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 97 478 2.0E-54
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 84 478 2.0E-54
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 83 502 2.0E-54
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 100 465 2.0E-54
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 84 455 3.0E-54
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 84 472 3.0E-54
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 84 478 3.0E-54
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 84 460 3.0E-54
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 102 465 3.0E-54
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 84 460 3.0E-54
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 84 459 3.0E-54
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 84 472 3.0E-54
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 102 465 3.0E-54
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 84 525 4.0E-54
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 77 461 4.0E-54
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 100 465 4.0E-54
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 84 460 4.0E-54
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 84 461 4.0E-54
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 84 461 4.0E-54
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 84 463 4.0E-54
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 62 459 4.0E-54
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 59 460 5.0E-54
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 87 476 5.0E-54
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 84 477 5.0E-54
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 84 503 5.0E-54
sp|Q754U8|PRP5_ASHGO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP5 PE=3 SV=2 84 466 6.0E-54
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 89 455 6.0E-54
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 84 480 6.0E-54
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 84 461 6.0E-54
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 88 481 6.0E-54
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 84 499 7.0E-54
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 83 460 7.0E-54
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 84 489 7.0E-54
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 79 502 7.0E-54
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 84 493 7.0E-54
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 32 473 7.0E-54
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 84 461 8.0E-54
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 89 478 9.0E-54
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 84 473 9.0E-54
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 84 525 9.0E-54
sp|P0A2P0|RHLB_SALTY ATP-dependent RNA helicase RhlB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhlB PE=3 SV=2 84 493 1.0E-53
sp|P0A2P1|RHLB_SALTI ATP-dependent RNA helicase RhlB OS=Salmonella typhi GN=rhlB PE=3 SV=2 84 493 1.0E-53
sp|B4TNT3|RHLB_SALSV ATP-dependent RNA helicase RhlB OS=Salmonella schwarzengrund (strain CVM19633) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|C0Q2V9|RHLB_SALPC ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi C (strain RKS4594) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|A9MXF3|RHLB_SALPB ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|B4SZ26|RHLB_SALNS ATP-dependent RNA helicase RhlB OS=Salmonella newport (strain SL254) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|B4TB13|RHLB_SALHS ATP-dependent RNA helicase RhlB OS=Salmonella heidelberg (strain SL476) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|B5RFS3|RHLB_SALG2 ATP-dependent RNA helicase RhlB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|B5QVH2|RHLB_SALEP ATP-dependent RNA helicase RhlB OS=Salmonella enteritidis PT4 (strain P125109) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|Q57HT6|RHLB_SALCH ATP-dependent RNA helicase RhlB OS=Salmonella choleraesuis (strain SC-B67) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|B5EZ40|RHLB_SALA4 ATP-dependent RNA helicase RhlB OS=Salmonella agona (strain SL483) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 84 460 1.0E-53
sp|Q8GXD6|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2 89 455 1.0E-53
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 84 460 1.0E-53
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 84 460 1.0E-53
sp|A7MQI2|RHLB_CROS8 ATP-dependent RNA helicase RhlB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhlB PE=3 SV=1 84 460 1.0E-53
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 84 460 1.0E-53
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 84 460 1.0E-53
sp|B5BIS9|RHLB_SALPK ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi A (strain AKU_12601) GN=rhlB PE=3 SV=1 84 493 1.0E-53
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 84 460 2.0E-53
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 93 478 2.0E-53
sp|B1LLV3|RHLB_ECOSM ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhlB PE=3 SV=1 84 493 2.0E-53
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 80 474 2.0E-53
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 80 474 2.0E-53
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 88 455 2.0E-53
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 84 461 2.0E-53
sp|A9MJ29|RHLB_SALAR ATP-dependent RNA helicase RhlB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rhlB PE=3 SV=1 84 493 2.0E-53
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 26 461 2.0E-53
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 77 461 2.0E-53
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 101 465 2.0E-53
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 84 493 3.0E-53
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 78 480 3.0E-53
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 84 460 3.0E-53
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 84 485 3.0E-53
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 84 455 3.0E-53
sp|B7LU75|RHLB_ESCF3 ATP-dependent RNA helicase RhlB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhlB PE=3 SV=1 84 493 3.0E-53
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 84 480 3.0E-53
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 84 525 3.0E-53
sp|Q8XAT4|RHLB_ECO57 ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 GN=rhlB PE=3 SV=3 84 493 3.0E-53
sp|B7NTG2|RHLB_ECO7I ATP-dependent RNA helicase RhlB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhlB PE=3 SV=1 84 493 3.0E-53
sp|A4WG30|RHLB_ENT38 ATP-dependent RNA helicase RhlB OS=Enterobacter sp. (strain 638) GN=rhlB PE=3 SV=1 84 460 3.0E-53
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 77 461 4.0E-53
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 84 455 4.0E-53
sp|Q3YVI4|RHLB_SHISS ATP-dependent RNA helicase RhlB OS=Shigella sonnei (strain Ss046) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|P0A8K0|RHLB_SHIFL ATP-dependent RNA helicase RhlB OS=Shigella flexneri GN=rhlB PE=3 SV=2 84 493 4.0E-53
sp|Q1R4F9|RHLB_ECOUT ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain UTI89 / UPEC) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B6I4B6|RHLB_ECOSE ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SE11) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|P0A8J8|RHLB_ECOLI ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12) GN=rhlB PE=1 SV=2 84 493 4.0E-53
sp|B1IWC0|RHLB_ECOLC ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|P0A8J9|RHLB_ECOL6 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhlB PE=3 SV=2 84 493 4.0E-53
sp|Q0TAU3|RHLB_ECOL5 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|A1AHV0|RHLB_ECOK1 ATP-dependent RNA helicase RhlB OS=Escherichia coli O1:K1 / APEC GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|A8A6N4|RHLB_ECOHS ATP-dependent RNA helicase RhlB OS=Escherichia coli O9:H4 (strain HS) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B1X9Z4|RHLB_ECODH ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / DH10B) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|C4ZZ48|RHLB_ECOBW ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B7M5C7|RHLB_ECO8A ATP-dependent RNA helicase RhlB OS=Escherichia coli O8 (strain IAI1) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B7MR01|RHLB_ECO81 ATP-dependent RNA helicase RhlB OS=Escherichia coli O81 (strain ED1a) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B7L8B6|RHLB_ECO55 ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain 55989 / EAEC) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B7MGJ1|RHLB_ECO45 ATP-dependent RNA helicase RhlB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|B7UMN5|RHLB_ECO27 ATP-dependent RNA helicase RhlB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|A7ZTY2|RHLB_ECO24 ATP-dependent RNA helicase RhlB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhlB PE=3 SV=1 84 493 4.0E-53
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 84 467 5.0E-53
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 84 467 5.0E-53
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 84 467 5.0E-53
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 23 460 5.0E-53
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 84 460 5.0E-53
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 84 480 5.0E-53
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 77 461 5.0E-53
sp|B7NF85|RHLB_ECOLU ATP-dependent RNA helicase RhlB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhlB PE=3 SV=1 84 460 5.0E-53
sp|B5YY28|RHLB_ECO5E ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhlB PE=3 SV=1 84 493 5.0E-53
sp|A6TGG9|RHLB_KLEP7 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rhlB PE=3 SV=1 84 460 5.0E-53
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 89 460 6.0E-53
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 84 455 6.0E-53
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 93 481 6.0E-53
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 84 469 6.0E-53
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 84 460 6.0E-53
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 84 480 6.0E-53
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 84 480 6.0E-53
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 84 480 6.0E-53
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 84 480 6.0E-53
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 84 480 6.0E-53
sp|Q65RG7|RHLB_MANSM ATP-dependent RNA helicase RhlB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rhlB PE=3 SV=1 84 484 7.0E-53
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 84 480 7.0E-53
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 84 460 7.0E-53
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 84 480 7.0E-53
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 67 461 7.0E-53
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 84 548 7.0E-53
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 89 460 7.0E-53
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 84 480 8.0E-53
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 84 480 8.0E-53
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 84 489 8.0E-53
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 60 463 9.0E-53
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 84 461 9.0E-53
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 84 472 1.0E-52
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 84 460 1.0E-52
sp|Q9FZ92|RH44_ARATH Putative DEAD-box ATP-dependent RNA helicase 44 OS=Arabidopsis thaliana GN=RH44 PE=5 SV=2 97 481 1.0E-52
sp|B7VME9|RHLB_VIBTL ATP-dependent RNA helicase RhlB OS=Vibrio tasmaniensis (strain LGP32) GN=rhlB PE=3 SV=1 84 460 1.0E-52
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 84 480 1.0E-52
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 84 480 1.0E-52
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 84 467 1.0E-52
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 84 480 1.0E-52
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 77 461 1.0E-52
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 84 461 1.0E-52
sp|A4STJ7|RHLB_AERS4 ATP-dependent RNA helicase RhlB OS=Aeromonas salmonicida (strain A449) GN=rhlB PE=3 SV=1 84 460 1.0E-52
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 62 472 1.0E-52
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 84 480 1.0E-52
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 77 461 1.0E-52
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 84 488 1.0E-52
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 84 467 1.0E-52
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 93 481 2.0E-52
sp|Q31UK5|RHLB_SHIBS ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 4 (strain Sb227) GN=rhlB PE=3 SV=1 84 460 2.0E-52
sp|B2TU12|RHLB_SHIB3 ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rhlB PE=3 SV=1 84 460 2.0E-52
sp|B5XYY9|RHLB_KLEP3 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae (strain 342) GN=rhlB PE=3 SV=1 84 460 2.0E-52
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 88 461 2.0E-52
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 84 482 2.0E-52
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 84 482 2.0E-52
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 84 482 2.0E-52
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 87 455 2.0E-52
sp|B5FN74|RHLB_SALDC ATP-dependent RNA helicase RhlB OS=Salmonella dublin (strain CT_02021853) GN=rhlB PE=3 SV=1 84 493 2.0E-52
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 84 525 2.0E-52
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 62 472 2.0E-52
sp|A8ACT3|RHLB_CITK8 ATP-dependent RNA helicase RhlB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rhlB PE=3 SV=1 84 460 2.0E-52
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 79 540 2.0E-52
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 62 472 2.0E-52
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 84 469 2.0E-52
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 87 461 2.0E-52
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 77 461 2.0E-52
sp|B0TJ29|RHLB_SHEHH ATP-dependent RNA helicase RhlB OS=Shewanella halifaxensis (strain HAW-EB4) GN=rhlB PE=3 SV=1 84 460 2.0E-52
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 93 460 2.0E-52
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 78 461 2.0E-52
sp|A0KEG9|RHLB_AERHH ATP-dependent RNA helicase RhlB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rhlB PE=3 SV=1 84 460 3.0E-52
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 62 472 3.0E-52
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 89 465 3.0E-52
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 84 460 3.0E-52
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 84 460 3.0E-52
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 84 461 3.0E-52
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 84 455 4.0E-52
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 96 495 4.0E-52
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 84 469 4.0E-52
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 84 467 4.0E-52
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 84 540 4.0E-52
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 84 467 4.0E-52
sp|A5UDI1|RHLB_HAEIE ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittEE) GN=rhlB PE=3 SV=1 84 460 5.0E-52
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 63 460 5.0E-52
sp|Q9CJS1|RHLB_PASMU ATP-dependent RNA helicase RhlB OS=Pasteurella multocida (strain Pm70) GN=rhlB PE=3 SV=1 84 460 5.0E-52
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 75 513 5.0E-52
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 84 487 5.0E-52
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 84 460 5.0E-52
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 84 460 5.0E-52
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 80 461 5.0E-52
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 102 455 6.0E-52
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 84 460 6.0E-52
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 80 461 6.0E-52
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 84 461 6.0E-52
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 89 469 6.0E-52
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 84 460 6.0E-52
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 84 460 6.0E-52
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 84 460 6.0E-52
sp|A8GZJ0|RHLB_SHEPA ATP-dependent RNA helicase RhlB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rhlB PE=3 SV=1 84 460 6.0E-52
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 77 461 7.0E-52
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 102 460 7.0E-52
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 84 472 7.0E-52
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 84 467 8.0E-52
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 84 480 8.0E-52
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 84 460 8.0E-52
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 84 481 8.0E-52
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 89 481 8.0E-52
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 77 461 9.0E-52
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 89 455 9.0E-52
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 102 465 1.0E-51
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 84 480 1.0E-51
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 79 470 1.0E-51
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 84 467 1.0E-51
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 84 455 1.0E-51
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 96 461 1.0E-51
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 102 465 1.0E-51
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 93 481 1.0E-51
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 84 480 1.0E-51
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 101 465 1.0E-51
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 84 487 1.0E-51
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 84 472 1.0E-51
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 84 472 1.0E-51
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 23 473 1.0E-51
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 84 460 2.0E-51
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 84 472 2.0E-51
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 62 472 2.0E-51
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 84 480 2.0E-51
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 102 460 2.0E-51
sp|Q0I1X0|RHLB_HAES1 ATP-dependent RNA helicase RhlB OS=Haemophilus somnus (strain 129Pt) GN=rhlB PE=3 SV=1 84 460 2.0E-51
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 84 455 2.0E-51
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 84 471 2.0E-51
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 84 540 2.0E-51
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 84 460 2.0E-51
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 84 460 2.0E-51
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 84 455 2.0E-51
sp|Q9PA24|RHLB_XYLFA ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain 9a5c) GN=rhlB PE=3 SV=2 84 482 2.0E-51
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 80 461 2.0E-51
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 84 480 3.0E-51
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 84 473 3.0E-51
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 84 472 3.0E-51
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 80 461 3.0E-51
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 80 461 3.0E-51
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 80 461 3.0E-51
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 84 460 3.0E-51
sp|Q4P3W3|DBP10_USTMA ATP-dependent RNA helicase DBP10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP10 PE=3 SV=1 680 899 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0003724 RNA helicase activity Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0005634 nucleus Yes
GO:0003723 RNA binding Yes
GO:0004386 helicase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0043226 organelle No
GO:0032553 ribonucleotide binding No
GO:0008186 ATP-dependent activity, acting on RNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0097367 carbohydrate derivative binding No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0043227 membrane-bounded organelle No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0043231 intracellular membrane-bounded organelle No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3112
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3676
Ophiocordyceps australis map64 (Brazil) OphauB2|1222 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02769
Ophiocordyceps camponoti-rufipedis Ophun1|1851
Ophiocordyceps kimflemingae Ophio5|2244
Ophiocordyceps subramaniannii Hirsu2|5445

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1222
MPRRAQSLAPGVNEIDILGSILPAQDTNQGLAEADLDFDDIVNAPAKGTDDDDGDEAFIALKQAASYRKSSNLKG
RTVKKGGGFQAMGLNANLLKAIARKGFSVPTPIQRKTIPLVLDRKDVVGMARTGSGKTAAFVIPMIERLRAHSAR
FGSRALILSPSRELAIQTIKVVKEFSRGTDVKSVLLVGGDSLEEQFGFMTANPDIVIATPGRFLHLKVEMGLDLS
SIQYVVFDEADRLFEMGFATQLTEIVHALPASRQTLLFSATLPASLVDFARAGLQDPSLVRLDAETKVSPDLESA
FFSVKSAEKEGSLLHILHDVIRVPVGPPTGSQPSSDRSCRKRKRGPDASGGKGKPTEQSTIIFAATKHHVEYLAN
LLQFAGFAVSHVYGSLDQTARRIQVEQFRNGETNILVVTDVAARGIDIPILANVINYDFPPQPKVFVHRVGRTAR
AGKRGWSYSLVRDIDVPYLVDLQLFLARKLVVGQEHGEPSFSDDVVVGALSRDALETHIEWMNKTLEASDDMEAL
RRVAGKAEKLYMKSRNSASSQSAKRAKQIVASDGWMQRHRLFGEDVDGMEQARAAMLARISNFKPQETIFEVGHA
DKSTSEAAEVMKQLRKRLTPKNRKEAEQHGDNDFGSLHDEAQAPKDEDKEEDEEEEEEENEDARVEVCVLNPDSS
TKGKTDWRDSDVFMSYTPRTINAAQERAYGVHSGSAAQLHNGQAASFVQAARDAAMDLVTDESSRAFGLPSRPRM
RWDTKAKKYVARDNDADGSRTDSPRLIVGESGVKIAASFQSGRFDKWRRAHRLDAAPRVGQPERPVPAAAPHAPR
FKHRQIKAPKEADKYRDDFALRKKRVAEARHNRIGRFRDGMGSKRELKGLHDIRKARQQKEQRRAKNSRPSRKN*
Coding >OphauB2|1222
ATGCCTCGACGCGCACAATCGCTAGCCCCTGGGGTGAATGAGATTGACATCCTGGGCTCTATTCTTCCCGCACAA
GACACAAACCAAGGGCTTGCAGAGGCTGATCTGGACTTTGACGACATTGTCAATGCTCCTGCCAAGGGTACCGAC
GACGATGATGGCGACGAAGCCTTTATTGCGCTTAAGCAGGCGGCGTCTTATCGCAAGTCATCAAATCTAAAGGGC
CGGACGGTCAAGAAGGGAGGAGGTTTTCAAGCCATGGGCCTTAATGCCAATCTGCTCAAGGCCATTGCTCGAAAG
GGGTTTTCCGTTCCAACCCCCATCCAGAGAAAGACGATTCCTCTGGTACTCGACAGAAAAGACGTTGTCGGCATG
GCTAGGACAGGTTCTGGCAAAACAGCAGCCTTTGTCATTCCAATGATTGAGCGACTGCGCGCCCACAGTGCTCGC
TTCGGCAGCCGCGCCTTGATTCTATCTCCCTCTCGAGAGCTAGCTATCCAGACCATCAAGGTTGTCAAGGAATTC
TCACGCGGCACAGATGTCAAGTCGGTTCTTCTTGTTGGTGGCGACAGTCTCGAGGAACAGTTTGGCTTCATGACT
GCCAACCCAGACATCGTCATTGCCACGCCTGGCCGATTTCTGCATCTCAAAGTTGAAATGGGACTCGATCTCTCG
TCTATTCAATACGTCGTGTTTGATGAAGCAGATCGGTTGTTTGAGATGGGCTTTGCAACCCAGCTCACAGAAATT
GTGCATGCCTTGCCCGCATCAAGACAGACTCTGCTCTTCTCTGCCACTCTGCCAGCGTCATTGGTTGACTTCGCG
CGCGCAGGCCTCCAGGACCCCAGTCTTGTTCGTCTAGATGCTGAGACCAAGGTGTCTCCTGACTTGGAGAGTGCC
TTCTTCTCGGTAAAGAGCGCAGAAAAGGAAGGGTCCTTGCTCCACATCCTACACGACGTCATCAGAGTCCCTGTT
GGCCCCCCCACCGGCTCACAGCCGTCAAGCGACCGAAGTTGCAGGAAGCGGAAAAGGGGACCAGATGCCTCGGGC
GGCAAAGGCAAGCCTACTGAGCAGTCGACCATTATCTTTGCCGCCACGAAGCATCATGTCGAGTACCTGGCCAAC
CTGCTGCAATTTGCAGGCTTCGCCGTATCTCACGTATATGGTTCTTTAGATCAAACGGCACGGCGGATTCAGGTG
GAGCAATTCCGTAACGGTGAAACAAATATCCTCGTCGTCACCGATGTTGCCGCGCGAGGCATCGACATTCCAATT
CTCGCCAATGTTATCAATTATGACTTTCCCCCTCAGCCCAAGGTTTTTGTACATCGCGTGGGCCGAACAGCGAGA
GCCGGAAAGAGAGGCTGGAGCTACAGTCTGGTGCGAGACATTGACGTGCCCTATCTGGTCGATCTTCAGCTATTT
CTGGCTAGAAAACTGGTTGTTGGCCAAGAGCATGGCGAACCATCGTTTTCTGACGATGTCGTCGTGGGCGCTCTG
TCGCGAGACGCTCTTGAAACCCACATTGAGTGGATGAATAAGACGCTGGAAGCGAGCGACGACATGGAGGCGCTG
CGCCGTGTAGCAGGCAAGGCTGAAAAGCTATACATGAAGAGCCGCAACTCGGCCTCGAGCCAGAGCGCCAAGAGG
GCGAAGCAAATTGTCGCTTCGGATGGCTGGATGCAGCGTCACCGGCTCTTTGGTGAAGACGTGGATGGCATGGAG
CAGGCGCGCGCCGCCATGCTGGCTCGAATCAGCAACTTCAAGCCGCAAGAAACCATTTTCGAGGTGGGACACGCT
GACAAGTCGACGAGCGAGGCCGCAGAGGTGATGAAGCAGCTGCGTAAAAGATTAACGCCCAAAAATAGAAAAGAA
GCAGAGCAGCATGGCGACAATGACTTTGGCAGTTTGCATGACGAGGCCCAGGCGCCCAAGGACGAGGACAAGGAG
GAGGACGAGGAGGAGGAGGAGGAGGAGAACGAGGACGCCAGGGTGGAAGTCTGCGTCTTGAATCCTGACAGCAGC
ACCAAGGGCAAGACTGATTGGCGCGACTCAGACGTCTTCATGTCCTACACGCCCCGCACGATAAACGCGGCGCAG
GAACGCGCATATGGCGTCCACTCTGGCAGCGCCGCCCAGCTGCACAATGGCCAGGCGGCATCCTTTGTCCAGGCC
GCCCGCGACGCCGCCATGGACCTGGTGACGGACGAGTCGTCGCGCGCCTTTGGCCTGCCCTCGCGGCCCCGCATG
CGCTGGGACACCAAGGCCAAAAAGTATGTGGCGCGCGACAATGACGCCGACGGCTCCCGCACCGACTCGCCGCGC
CTCATTGTTGGAGAGAGCGGCGTCAAGATTGCTGCCTCGTTTCAGAGCGGCCGCTTCGACAAGTGGCGCCGCGCC
CACCGCCTCGATGCTGCGCCCCGTGTCGGCCAGCCTGAGCGTCCCGTGCCGGCGGCCGCGCCCCACGCGCCCCGG
TTCAAGCATCGCCAGATCAAGGCGCCCAAGGAGGCAGACAAGTATCGCGACGACTTTGCCCTCCGCAAGAAGCGC
GTCGCCGAGGCTCGCCACAATCGCATTGGCCGCTTCCGCGACGGCATGGGCAGCAAAAGGGAGCTCAAGGGCCTC
CACGACATTCGCAAGGCCAGGCAGCAAAAGGAACAGCGCAGGGCCAAGAATTCTCGTCCGTCACGCAAAAATTGA
Transcript >OphauB2|1222
ATGCCTCGACGCGCACAATCGCTAGCCCCTGGGGTGAATGAGATTGACATCCTGGGCTCTATTCTTCCCGCACAA
GACACAAACCAAGGGCTTGCAGAGGCTGATCTGGACTTTGACGACATTGTCAATGCTCCTGCCAAGGGTACCGAC
GACGATGATGGCGACGAAGCCTTTATTGCGCTTAAGCAGGCGGCGTCTTATCGCAAGTCATCAAATCTAAAGGGC
CGGACGGTCAAGAAGGGAGGAGGTTTTCAAGCCATGGGCCTTAATGCCAATCTGCTCAAGGCCATTGCTCGAAAG
GGGTTTTCCGTTCCAACCCCCATCCAGAGAAAGACGATTCCTCTGGTACTCGACAGAAAAGACGTTGTCGGCATG
GCTAGGACAGGTTCTGGCAAAACAGCAGCCTTTGTCATTCCAATGATTGAGCGACTGCGCGCCCACAGTGCTCGC
TTCGGCAGCCGCGCCTTGATTCTATCTCCCTCTCGAGAGCTAGCTATCCAGACCATCAAGGTTGTCAAGGAATTC
TCACGCGGCACAGATGTCAAGTCGGTTCTTCTTGTTGGTGGCGACAGTCTCGAGGAACAGTTTGGCTTCATGACT
GCCAACCCAGACATCGTCATTGCCACGCCTGGCCGATTTCTGCATCTCAAAGTTGAAATGGGACTCGATCTCTCG
TCTATTCAATACGTCGTGTTTGATGAAGCAGATCGGTTGTTTGAGATGGGCTTTGCAACCCAGCTCACAGAAATT
GTGCATGCCTTGCCCGCATCAAGACAGACTCTGCTCTTCTCTGCCACTCTGCCAGCGTCATTGGTTGACTTCGCG
CGCGCAGGCCTCCAGGACCCCAGTCTTGTTCGTCTAGATGCTGAGACCAAGGTGTCTCCTGACTTGGAGAGTGCC
TTCTTCTCGGTAAAGAGCGCAGAAAAGGAAGGGTCCTTGCTCCACATCCTACACGACGTCATCAGAGTCCCTGTT
GGCCCCCCCACCGGCTCACAGCCGTCAAGCGACCGAAGTTGCAGGAAGCGGAAAAGGGGACCAGATGCCTCGGGC
GGCAAAGGCAAGCCTACTGAGCAGTCGACCATTATCTTTGCCGCCACGAAGCATCATGTCGAGTACCTGGCCAAC
CTGCTGCAATTTGCAGGCTTCGCCGTATCTCACGTATATGGTTCTTTAGATCAAACGGCACGGCGGATTCAGGTG
GAGCAATTCCGTAACGGTGAAACAAATATCCTCGTCGTCACCGATGTTGCCGCGCGAGGCATCGACATTCCAATT
CTCGCCAATGTTATCAATTATGACTTTCCCCCTCAGCCCAAGGTTTTTGTACATCGCGTGGGCCGAACAGCGAGA
GCCGGAAAGAGAGGCTGGAGCTACAGTCTGGTGCGAGACATTGACGTGCCCTATCTGGTCGATCTTCAGCTATTT
CTGGCTAGAAAACTGGTTGTTGGCCAAGAGCATGGCGAACCATCGTTTTCTGACGATGTCGTCGTGGGCGCTCTG
TCGCGAGACGCTCTTGAAACCCACATTGAGTGGATGAATAAGACGCTGGAAGCGAGCGACGACATGGAGGCGCTG
CGCCGTGTAGCAGGCAAGGCTGAAAAGCTATACATGAAGAGCCGCAACTCGGCCTCGAGCCAGAGCGCCAAGAGG
GCGAAGCAAATTGTCGCTTCGGATGGCTGGATGCAGCGTCACCGGCTCTTTGGTGAAGACGTGGATGGCATGGAG
CAGGCGCGCGCCGCCATGCTGGCTCGAATCAGCAACTTCAAGCCGCAAGAAACCATTTTCGAGGTGGGACACGCT
GACAAGTCGACGAGCGAGGCCGCAGAGGTGATGAAGCAGCTGCGTAAAAGATTAACGCCCAAAAATAGAAAAGAA
GCAGAGCAGCATGGCGACAATGACTTTGGCAGTTTGCATGACGAGGCCCAGGCGCCCAAGGACGAGGACAAGGAG
GAGGACGAGGAGGAGGAGGAGGAGGAGAACGAGGACGCCAGGGTGGAAGTCTGCGTCTTGAATCCTGACAGCAGC
ACCAAGGGCAAGACTGATTGGCGCGACTCAGACGTCTTCATGTCCTACACGCCCCGCACGATAAACGCGGCGCAG
GAACGCGCATATGGCGTCCACTCTGGCAGCGCCGCCCAGCTGCACAATGGCCAGGCGGCATCCTTTGTCCAGGCC
GCCCGCGACGCCGCCATGGACCTGGTGACGGACGAGTCGTCGCGCGCCTTTGGCCTGCCCTCGCGGCCCCGCATG
CGCTGGGACACCAAGGCCAAAAAGTATGTGGCGCGCGACAATGACGCCGACGGCTCCCGCACCGACTCGCCGCGC
CTCATTGTTGGAGAGAGCGGCGTCAAGATTGCTGCCTCGTTTCAGAGCGGCCGCTTCGACAAGTGGCGCCGCGCC
CACCGCCTCGATGCTGCGCCCCGTGTCGGCCAGCCTGAGCGTCCCGTGCCGGCGGCCGCGCCCCACGCGCCCCGG
TTCAAGCATCGCCAGATCAAGGCGCCCAAGGAGGCAGACAAGTATCGCGACGACTTTGCCCTCCGCAAGAAGCGC
GTCGCCGAGGCTCGCCACAATCGCATTGGCCGCTTCCGCGACGGCATGGGCAGCAAAAGGGAGCTCAAGGGCCTC
CACGACATTCGCAAGGCCAGGCAGCAAAAGGAACAGCGCAGGGCCAAGAATTCTCGTCCGTCACGCAAAAATTGA
Gene >OphauB2|1222
ATGCCTCGACGCGCACAATCGCTAGCCCCTGGGGTGAATGAGATTGACATCCTGGGCTCTATTCTTCCCGCACAA
GACACAAACCAAGGGCTTGCAGAGGCTGATCTGGACTTTGACGACATTGTCAATGCTCCTGCCAAGGGTACCGAC
GACGATGATGGCGACGAAGCCTTTATTGCGCTTAAGCAGGCGGCGTCTTATCGCAAGTCATCAAATCTAAAGGGC
CGGACGGTCAAGAAGGGAGGAGGTTTTCAAGCCATGGGTCAGTTCTACGGATTGCCACAGCATGCGAATAGTAGT
TGCTGACACCCGGACCCAGGCCTTAATGCCAATCTGCTCAAGGCCATTGCTCGAAAGGGGTTTTCCGTTCCAACC
CCCATCCAGAGAAAGACGATTCCTCTGGTACTCGACAGAAAAGACGTTGTCGGCATGGCTAGGACAGGTTCTGGC
AAAACAGCAGCCTTTGTCATTCCAATGATTGAGCGACTGCGCGCCCACAGTGCTCGCTTCGGCAGCCGCGCCTTG
ATTCTATCTCCCTCTCGAGAGCTAGCTATCCAGACCATCAAGGTTGTCAAGGAATTCTCACGCGGCACAGATGTC
AAGTCGGTTCTTCTTGTTGGTGGCGACAGTCTCGAGGAACAGTTTGGCTTCATGACTGCCAACCCAGACATCGTC
ATTGCCACGCCTGGCCGATTTCTGCATCTCAAAGTTGAAATGGGACTCGATCTCTCGTCTATTCAATACGTCGTG
TTTGATGAAGCAGATCGGTTGTTTGAGATGGGCTTTGCAACCCAGCTCACAGAAATTGTGCATGCCTTGCCCGCA
TCAAGACAGACTCTGCTCTTCTCTGCCACTCTGCCAGCGTCATTGGTTGACTTCGCGCGCGCAGGCCTCCAGGAC
CCCAGTCTTGTTCGTCTAGATGCTGAGACCAAGGTGTCTCCTGACTTGGAGAGTGCCTTCTTCTCGGTAAAGAGC
GCAGAAAAGGAAGGGTCCTTGCTCCACATCCTACACGACGTCATCAGAGTCCCTGTTGGCCCCCCCACCGGCTCA
CAGCCGTCAAGCGACCGAAGTTGCAGGAAGCGGAAAAGGGGACCAGATGCCTCGGGCGGCAAAGGCAAGCCTACT
GAGCAGTCGACCATTATCTTTGCCGCCACGAAGCATCATGTCGAGTACCTGGCCAACCTGCTGCAATTTGCAGGC
TTCGCCGTATCTCACGTATATGGTTCTTTAGATCAAACGGCACGGCGGATTCAGGTGGAGCAATTCCGTAACGGT
GAAACAAATATCCTCGTCGTCACCGATGTTGCCGCGCGAGGCATCGACATTCCAATTCTCGCCAATGTTATCAAT
TATGACTTTCCCCCTCAGCCCAAGGTTTTTGTACATCGCGTGGGCCGAACAGCGAGAGCCGGAAAGAGAGGCTGG
AGCTACAGTCTGGTGCGAGACATTGACGTGCCCTATCTGGTCGATCTTCAGCTATTTCTGGCTAGAAAACTGGTT
GTTGGCCAAGAGCATGGCGAACCATCGTTTTCTGACGATGTCGTCGTGGGCGCTCTGTCGCGAGACGCTCTTGAA
ACCCACATTGAGTGGATGAATAAGACGCTGGAAGCGAGCGACGACATGGAGGCGCTGCGCCGTGTAGCAGGCAAG
GCTGAAAAGCTATACATGAAGAGCCGCAACTCGGCCTCGAGCCAGAGCGCCAAGAGGGCGAAGCAAATTGTCGCT
TCGGATGGCTGGATGCAGCGTCACCGGCTCTTTGGTGAAGACGTGGATGGCATGGAGCAGGCGCGCGCCGCCATG
CTGGCTCGAATCAGCAACTTCAAGCCGCAAGAAACCATTTTCGAGGTGGGACACGCTGACAAGTCGACGAGCGAG
GCCGCAGAGGTGATGAAGCAGCTGCGTAAAAGATTAACGCCCAAAAATAGAAAAGAAGCAGAGCAGCATGGCGAC
AATGACTTTGGCAGTTTGCATGACGAGGCCCAGGCGCCCAAGGACGAGGACAAGGAGGAGGACGAGGAGGAGGAG
GAGGAGGAGAACGAGGACGCCAGGGTGGAAGTCTGCGTCTTGAATCCTGACAGCAGCACCAAGGGCAAGACTGAT
TGGCGCGACTCAGACGTCTTCATGTCCTACACGCCCCGCACGATAAACGCGGCGCAGGAACGCGCATATGGCGTC
CACTCTGGCAGCGCCGCCCAGCTGCACAATGGCCAGGCGGCATCCTTTGTCCAGGCCGCCCGCGACGCCGCCATG
GACCTGGTGACGGACGAGTCGTCGCGCGCCTTTGGCCTGCCCTCGCGGCCCCGCATGCGCTGGGACACCAAGGCC
AAAAAGTATGTGGCGCGCGACAATGACGCCGACGGCTCCCGCACCGACTCGCCGCGCCTCATTGTTGGAGAGAGC
GGCGTCAAGATTGCTGCCTCGTTTCAGAGCGGCCGCTTCGACAAGTGGCGCCGCGCCCACCGCCTCGATGCTGCG
CCCCGTGTCGGCCAGCCTGAGCGTCCCGTGCCGGCGGCCGCGCCCCACGCGCCCCGGTTCAAGCATCGCCAGATC
AAGGCGCCCAAGGAGGCAGACAAGTATCGCGACGACTTTGCCCTCCGCAAGAAGCGCGTCGCCGAGGCTCGCCAC
AATCGCATTGGCCGCTTCCGCGACGGCATGGGCAGCAAAAGGGAGCTCAAGGGCCTCCACGACATTCGCAAGGCC
AGGCAGCAAAAGGAACAGCGCAGGGCCAAGAATTCTCGTCCGTCACGCAAAAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail