Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1219
Gene name
LocationContig_13:92860..97759
Strand-
Gene length (bp)4899
Transcript length (bp)4806
Coding sequence length (bp)4806
Protein length (aa) 1602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12257 IML1 Vacuolar membrane-associated protein Iml1 2.0E-114 154 457
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 1.3E-24 1201 1275
PF19418 DEPDC5_CTD DEPDC5 protein C-terminal region 6.9E-09 1308 1397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0S0|IML1_CHAGB Vacuolar membrane-associated protein IML1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML1 PE=3 SV=1 44 1478 0.0E+00
sp|Q4WHH4|IML1_ASPFU Vacuolar membrane-associated protein iml1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml1 PE=3 SV=1 42 1586 0.0E+00
sp|Q5AW24|IML1_EMENI Vacuolar membrane-associated protein iml1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iml1 PE=3 SV=1 100 1570 0.0E+00
sp|A1DFV9|IML1_NEOFI Vacuolar membrane-associated protein iml1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml1 PE=3 SV=1 42 1581 0.0E+00
sp|Q1E9Q9|IML1_COCIM Vacuolar membrane-associated protein IML1 OS=Coccidioides immitis (strain RS) GN=IML1 PE=3 SV=2 41 1568 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0S0|IML1_CHAGB Vacuolar membrane-associated protein IML1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML1 PE=3 SV=1 44 1478 0.0E+00
sp|Q4WHH4|IML1_ASPFU Vacuolar membrane-associated protein iml1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml1 PE=3 SV=1 42 1586 0.0E+00
sp|Q5AW24|IML1_EMENI Vacuolar membrane-associated protein iml1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iml1 PE=3 SV=1 100 1570 0.0E+00
sp|A1DFV9|IML1_NEOFI Vacuolar membrane-associated protein iml1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml1 PE=3 SV=1 42 1581 0.0E+00
sp|Q1E9Q9|IML1_COCIM Vacuolar membrane-associated protein IML1 OS=Coccidioides immitis (strain RS) GN=IML1 PE=3 SV=2 41 1568 0.0E+00
sp|Q2UMR9|IML1_ASPOR Vacuolar membrane-associated protein iml1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=iml1 PE=3 SV=2 42 1581 0.0E+00
sp|A1CEE0|IML1_ASPCL Vacuolar membrane-associated protein iml1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=iml1 PE=3 SV=1 100 1572 0.0E+00
sp|A4R596|IML1_MAGO7 Vacuolar membrane-associated protein IML1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML1 PE=3 SV=2 736 1478 0.0E+00
sp|A4R596|IML1_MAGO7 Vacuolar membrane-associated protein IML1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML1 PE=3 SV=2 42 647 0.0E+00
sp|Q7S9J6|IML1_NEUCR Vacuolar membrane-associated protein iml1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml1 PE=3 SV=1 44 1594 0.0E+00
sp|Q0CHV5|IML1_ASPTN Vacuolar membrane-associated protein iml1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml1 PE=3 SV=1 853 1589 4.0E-152
sp|Q0CHV5|IML1_ASPTN Vacuolar membrane-associated protein iml1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml1 PE=3 SV=1 42 565 9.0E-113
sp|O74788|IML1_SCHPO Vacuolar membrane-associated protein iml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iml1 PE=1 SV=1 853 1478 4.0E-91
sp|Q5AIA4|IML1_CANAL Vacuolar membrane-associated protein IML1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IML1 PE=3 SV=1 848 1477 9.0E-87
sp|P47170|IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IML1 PE=1 SV=1 803 1500 3.0E-85
sp|A3LRB2|IML1_PICST Vacuolar membrane-associated protein IML1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IML1 PE=3 SV=2 884 1488 5.0E-84
sp|Q6CAP3|IML1_YARLI Vacuolar membrane-associated protein IML1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IML1 PE=3 SV=1 868 1479 5.0E-79
sp|Q75DV2|IML1_ASHGO Vacuolar membrane-associated protein IML1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IML1 PE=3 SV=2 859 1495 5.0E-79
sp|Q6CWI2|IML1_KLULA Vacuolar membrane-associated protein IML1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IML1 PE=3 SV=1 808 1477 2.0E-78
sp|Q6BN00|IML1_DEBHA Vacuolar membrane-associated protein IML1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IML1 PE=3 SV=2 868 1488 3.0E-77
sp|Q6FK84|IML1_CANGA Vacuolar membrane-associated protein IML1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IML1 PE=3 SV=1 857 1497 1.0E-75
sp|Q4PE51|IML1_USTMA Vacuolar membrane-associated protein IML1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IML1 PE=3 SV=1 109 570 1.0E-71
sp|O74788|IML1_SCHPO Vacuolar membrane-associated protein iml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iml1 PE=1 SV=1 95 578 3.0E-69
sp|P0CO32|IML1_CRYNJ Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IML1 PE=3 SV=1 96 575 5.0E-61
sp|P0CO33|IML1_CRYNB Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IML1 PE=3 SV=1 96 575 5.0E-61
sp|Q54XA2|Y9099_DICDI DEP domain-containing protein DDB_G0279099 OS=Dictyostelium discoideum GN=DDB_G0279099 PE=3 SV=1 91 457 1.0E-60
sp|Q6CAP3|IML1_YARLI Vacuolar membrane-associated protein IML1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IML1 PE=3 SV=1 120 570 2.0E-57
sp|P61460|DEPD5_MOUSE DEP domain-containing protein 5 OS=Mus musculus GN=Depdc5 PE=1 SV=2 92 459 4.0E-54
sp|O75140|DEPD5_HUMAN DEP domain-containing protein 5 OS=Homo sapiens GN=DEPDC5 PE=1 SV=2 92 459 1.0E-53
sp|A3LRB2|IML1_PICST Vacuolar membrane-associated protein IML1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IML1 PE=3 SV=2 139 457 2.0E-52
sp|Q5AIA4|IML1_CANAL Vacuolar membrane-associated protein IML1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IML1 PE=3 SV=1 135 565 5.0E-50
sp|P47170|IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IML1 PE=1 SV=1 43 576 7.0E-50
sp|Q6BN00|IML1_DEBHA Vacuolar membrane-associated protein IML1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IML1 PE=3 SV=2 137 611 9.0E-50
sp|Q6CWI2|IML1_KLULA Vacuolar membrane-associated protein IML1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IML1 PE=3 SV=1 91 577 1.0E-48
sp|Q6FK84|IML1_CANGA Vacuolar membrane-associated protein IML1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IML1 PE=3 SV=1 149 561 3.0E-48
sp|Q75DV2|IML1_ASHGO Vacuolar membrane-associated protein IML1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IML1 PE=3 SV=2 150 576 4.0E-44
sp|Q4PE51|IML1_USTMA Vacuolar membrane-associated protein IML1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IML1 PE=3 SV=1 870 1287 5.0E-43
sp|Q4PE51|IML1_USTMA Vacuolar membrane-associated protein IML1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IML1 PE=3 SV=1 1302 1493 2.0E-34
sp|P0CO32|IML1_CRYNJ Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IML1 PE=3 SV=1 890 1273 4.0E-22
sp|P0CO33|IML1_CRYNB Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IML1 PE=3 SV=1 890 1273 4.0E-22
sp|P0CO32|IML1_CRYNJ Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IML1 PE=3 SV=1 1302 1581 5.0E-22
sp|P0CO33|IML1_CRYNB Vacuolar membrane-associated protein IML1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IML1 PE=3 SV=1 1302 1581 5.0E-22
sp|P61460|DEPD5_MOUSE DEP domain-containing protein 5 OS=Mus musculus GN=Depdc5 PE=1 SV=2 906 1099 2.0E-16
sp|O75140|DEPD5_HUMAN DEP domain-containing protein 5 OS=Homo sapiens GN=DEPDC5 PE=1 SV=2 906 1099 2.0E-15
sp|Q54XA2|Y9099_DICDI DEP domain-containing protein DDB_G0279099 OS=Dictyostelium discoideum GN=DDB_G0279099 PE=3 SV=1 1317 1474 1.0E-08
sp|Q54XA2|Y9099_DICDI DEP domain-containing protein DDB_G0279099 OS=Dictyostelium discoideum GN=DDB_G0279099 PE=3 SV=1 843 974 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0005096 GTPase activator activity Yes
GO:0065007 biological regulation No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0008047 enzyme activator activity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0007165 signal transduction No
GO:0050794 regulation of cellular process No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1219
MSRKAGVEAGKRIGVGGMATTAARRGRRRGAEAMGDGAAGCCQVGIHEGYARDHVLLNLDVVAIEAGALVSMTVL
GGGIGASGKGWEHGEGPSEQQEPYVFVAKDMAPELKARHGGVEVVVAKHMADAFGIKKTAQVCLAAIDKVQRVTE
ATHVEITFKDYYLSRADMWRLTVGELAQRTVYRGQSILFLGTIKALVTAVYVDGRSVHSAFFVGHTRPIFRSESA
RHVLFIQMAREMWDFDSDGSGEIMFSRVVNGFLPAMFKRWAALKVKHLVSIVLFARVEYDTGLTTELADSDSYYT
GMQASGSRRPYKDFYRVVVSQMASGEWTKILYQLKREFNFFRRDISLHHQSADVACLDESDSLDIVKHVKAESSL
CVHGNILEAINLAASQFAHDYIDRDLYRTGISIAVITPGTGVFEVDYETLGRTTEALVVNGIGIDLICMSRMPLH
SVPLFKYRNPLFSWGPGSFARSVHSRGSTPNLETPVIGSYQSLEGSLSPTKAPPAEEWCFALPHWLHVSFWTGAS
DDALSYAGIALAVSNRVEQADEDEFRIRCRMYDLQMRSVLHVNEIETAPLQSDASYRVEAAAGSSPGARQHHVLY
KACRRAPDSLVDNVIGFQRFAPDRLVRAGDLSLWRQLQDFDDSRSRLAVKAPPQHGRGVIKGKLDEVERPRQQQQ
QQQQQQEQQQQQQQQQQQEQQQQQEQQQQAVVAAEDPSGRGGEGQSSSQGASKAAANGLGKGGPGKPKALMRHIS
LGLRGFGIAAAKPVVAQVKAENVSAVPAAAEASASASASASGARAGSLSPARSMPIAKGEGSQRHGAMTGRWSDE
GHVRDRNALRAEDAHKLYTNKLRAGVVPELAARVSPGSALAPWLSLLDPSCPDKHPLDDRMLYSRWQHVFPTTSD
MKEHKWKALCCPASVPLTTEYFPPRAQFDREWQRHPYNLDQSLDVEEEAGDRARHEFVKELISMRFSQGFQLIVG
PLVAQAFGHKPLKLADVFSRDEPLEDGASVFMSVGNTIHQLACVRGSEVEVTIYVRKALDTTPPPLYRAAIRTLL
DSTYHTRRIHFLRAQPERNWNAIDSYVAGHKDDMTEGMRFWRARFVLIPQRAEARSHSGDSPEELRIEGIKRLAQ
LWQKNRCLPPADARLPPAPLDIVYKTDDASLVIAADGDLLSLPDARRPRRRHGFVKTHLNLPALADAMQQPVDQG
GVPLRNRRWHLRTHSASFIGSDMTTWLLDNFTNVDDRDDAERLGNALMASDSHKGLFVHVERRHRFRDGNYFYRF
APDFAKPLPGWFASRRSLPPTDAPAPVLLSHVIKYDVDPRRRSYRPEHIHLHYDRLHNPDNCFHLRIDWLNKTSK
LVQDALEAWEREASQYGLRLVELPLHEACRITHSNPLRRPYHVPLALPPPDPPDATLARHFYLVALIKSFDFVLD
LEAAANFPPDLPVRYSWGPPDFCYSQYIHRSGTMLAQITDDGKLLVLANRLYSRAKPSPDAAPLHRTPSAPTPAQ
MLASSLTEPQAIAPSPLARPALQCHHWSPMARPLDPQPSVYTTRPESLKDDLEAFCSDAAALAAFYRETLDRTMR
PPAPETPLYSCPGLAARRLGGPGLFV*
Coding >OphauB2|1219
ATGTCTCGCAAGGCGGGCGTGGAAGCTGGCAAACGGATTGGTGTGGGCGGCATGGCCACAACGGCAGCGCGGCGT
GGGCGACGGCGAGGAGCAGAGGCCATGGGCGATGGGGCTGCAGGGTGCTGCCAGGTTGGCATCCACGAGGGCTAC
GCACGCGACCATGTGCTGCTCAATCTCGACGTGGTGGCGATTGAGGCGGGCGCGCTGGTGTCCATGACTGTGCTG
GGGGGCGGGATTGGCGCGTCGGGCAAGGGCTGGGAGCATGGCGAGGGGCCGTCGGAGCAGCAGGAGCCCTATGTC
TTTGTGGCCAAGGACATGGCGCCCGAGCTCAAGGCGCGTCACGGCGGCGTCGAGGTGGTGGTGGCCAAGCACATG
GCGGATGCGTTTGGCATCAAGAAGACGGCCCAAGTGTGCCTGGCGGCTATTGACAAGGTGCAGCGCGTCACCGAG
GCGACGCATGTGGAAATCACCTTCAAGGACTACTATCTGTCGCGCGCCGACATGTGGCGGCTGACGGTGGGGGAG
CTGGCGCAGCGGACCGTGTACCGCGGCCAGTCGATTCTCTTTCTCGGCACCATCAAGGCGCTGGTGACGGCCGTC
TATGTCGACGGGCGCAGCGTGCACTCGGCCTTTTTTGTCGGGCACACGCGGCCCATTTTCCGCAGCGAGTCGGCG
CGGCATGTGCTCTTTATCCAGATGGCGCGCGAAATGTGGGATTTCGACTCGGACGGGTCGGGGGAAATCATGTTT
AGCCGCGTCGTCAACGGCTTCCTGCCCGCCATGTTCAAGCGATGGGCGGCGCTCAAGGTCAAGCACCTGGTGAGC
ATTGTGCTCTTTGCGCGCGTCGAGTACGACACGGGCCTGACGACGGAGCTGGCCGACAGCGACTCGTACTACACG
GGCATGCAGGCGTCGGGCAGCCGGCGGCCCTACAAGGACTTTTACCGCGTCGTCGTCAGCCAGATGGCCAGCGGC
GAGTGGACCAAGATTCTCTACCAGCTCAAGCGAGAGTTCAACTTTTTCCGCCGCGACATTAGCCTGCATCACCAG
TCGGCCGACGTGGCTTGCCTCGACGAGAGCGACAGTCTGGACATTGTCAAGCACGTCAAGGCCGAGTCGTCGCTG
TGCGTGCACGGCAACATTCTCGAGGCCATCAACCTGGCGGCCTCGCAGTTTGCCCACGACTACATTGACCGCGAC
CTCTACCGCACCGGCATTTCCATTGCCGTCATCACGCCCGGCACTGGCGTCTTTGAAGTCGACTATGAGACGCTT
GGCCGCACCACCGAGGCGCTGGTGGTTAATGGCATAGGCATCGACCTGATTTGCATGTCGAGGATGCCGCTGCAC
TCGGTTCCTCTCTTCAAGTATCGCAACCCCCTCTTTTCTTGGGGCCCAGGCTCCTTTGCGCGCTCGGTGCACAGC
CGCGGCAGCACGCCCAACCTCGAGACGCCAGTCATTGGCAGCTACCAGTCTCTCGAGGGGTCTCTGTCGCCCACC
AAGGCACCACCTGCTGAAGAGTGGTGCTTTGCTCTGCCGCACTGGCTCCACGTGTCCTTTTGGACGGGCGCGTCG
GACGATGCCCTCTCCTACGCCGGCATTGCTCTTGCCGTGTCCAACCGAGTGGAGCAGGCTGACGAGGACGAGTTT
CGCATCCGATGCCGCATGTATGATTTGCAGATGCGCAGCGTGCTCCATGTCAATGAGATTGAAACGGCACCGCTG
CAGAGCGACGCCAGCTACAGGGTAGAGGCGGCGGCGGGCTCGAGCCCTGGGGCACGGCAGCACCACGTCTTGTAC
AAGGCGTGCCGGCGCGCGCCCGACAGCCTGGTGGACAATGTGATTGGCTTCCAGCGCTTTGCTCCGGACAGGCTT
GTGCGGGCGGGCGACTTGTCGCTATGGAGACAGCTGCAGGACTTTGACGACTCGAGGAGCCGCCTGGCGGTCAAG
GCGCCGCCGCAGCATGGGCGAGGCGTCATCAAGGGCAAGCTGGACGAGGTGGAGCGCCCAAGGCAGCAGCAGCAG
CAGCAGCAGCAGCAACAAGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAAGAGCAGCAGCAGCAACAAGAG
CAGCAGCAGCAGGCGGTGGTGGCGGCGGAGGACCCGAGTGGAAGAGGGGGAGAGGGCCAGAGCAGCAGCCAAGGG
GCGAGCAAGGCGGCGGCGAATGGGCTTGGCAAGGGTGGCCCTGGCAAGCCCAAGGCCCTCATGAGACACATCAGC
TTGGGGCTGCGCGGCTTCGGAATTGCGGCGGCCAAGCCAGTGGTGGCGCAGGTCAAGGCGGAAAACGTCAGCGCA
GTGCCGGCGGCAGCAGAGGCGTCGGCGTCGGCGTCGGCGTCGGCGTCGGGGGCCAGGGCCGGGTCGCTCTCGCCA
GCGCGCAGCATGCCCATTGCCAAGGGCGAGGGCAGCCAGCGGCACGGGGCCATGACGGGCAGGTGGAGCGACGAG
GGCCATGTGCGCGACCGCAACGCGCTGCGGGCCGAAGACGCGCACAAGCTCTACACCAACAAGCTGCGGGCGGGC
GTGGTGCCCGAGCTGGCGGCCAGAGTGTCGCCGGGCAGTGCCCTGGCGCCGTGGCTGAGCCTGCTGGACCCGTCG
TGCCCCGACAAGCACCCGCTCGACGACCGCATGCTCTACAGCCGCTGGCAGCACGTCTTCCCCACCACGTCGGAC
ATGAAGGAGCACAAGTGGAAGGCGCTCTGCTGCCCGGCGTCGGTGCCGCTGACGACGGAGTACTTCCCGCCCAGG
GCGCAGTTTGACCGCGAGTGGCAGCGCCACCCCTACAACCTGGACCAAAGCCTCGACGTGGAGGAGGAGGCGGGC
GACCGGGCGCGGCACGAGTTTGTCAAGGAGCTGATTAGCATGCGCTTCTCGCAGGGCTTCCAGCTCATTGTGGGC
CCGCTGGTGGCGCAGGCCTTTGGCCACAAGCCCCTCAAGCTGGCCGACGTGTTTTCGCGCGACGAGCCGCTCGAG
GACGGCGCCAGCGTCTTCATGTCGGTGGGCAACACCATCCACCAGCTGGCCTGCGTGCGCGGCAGCGAGGTGGAG
GTGACGATATACGTGCGCAAGGCGCTCGACACCACGCCGCCGCCCCTCTACCGCGCCGCCATTCGCACCCTGCTC
GACAGCACCTACCACACGCGCCGCATCCACTTCTTGCGCGCCCAGCCAGAGCGCAACTGGAACGCCATTGACTCG
TATGTCGCCGGCCACAAGGACGACATGACGGAGGGCATGCGCTTTTGGCGCGCGCGCTTTGTGCTGATTCCCCAG
CGGGCCGAGGCGCGCAGCCACAGCGGCGACAGCCCCGAGGAGCTGCGCATCGAGGGCATCAAGCGCCTGGCCCAG
CTGTGGCAAAAGAACCGCTGCTTGCCCCCCGCCGACGCCCGCCTGCCCCCCGCGCCCCTCGACATTGTCTACAAG
ACGGACGACGCCTCCCTCGTCATTGCCGCCGACGGCGACTTGCTGTCCCTGCCCGACGCCCGCCGCCCCCGCCGC
CGCCATGGCTTTGTCAAGACGCACCTCAACCTGCCCGCCCTGGCCGACGCCATGCAGCAGCCCGTCGACCAGGGC
GGCGTGCCCCTGCGCAACCGCCGCTGGCACCTGCGCACCCACTCCGCCTCCTTTATCGGCTCCGACATGACCACT
TGGCTGCTCGACAACTTTACAAACGTCGACGACCGCGACGACGCCGAGCGCCTCGGCAACGCCCTCATGGCCTCC
GACTCCCACAAGGGCCTCTTTGTCCACGTCGAGCGCCGCCACCGCTTCCGCGACGGCAACTACTTTTACCGCTTT
GCCCCCGACTTTGCCAAGCCCCTGCCCGGCTGGTTTGCCTCGCGCCGCTCTCTGCCCCCGACCGACGCCCCCGCC
CCCGTCTTGCTCAGCCACGTCATCAAGTACGACGTGGACCCCCGCCGCCGCTCCTACCGCCCCGAGCACATCCAC
CTCCACTATGACCGCCTGCACAACCCCGACAACTGCTTCCACCTGCGCATCGACTGGCTCAACAAGACGTCCAAG
CTGGTCCAGGACGCCCTCGAGGCCTGGGAGCGCGAGGCCAGCCAGTATGGCCTGCGCCTCGTCGAGCTGCCCCTG
CACGAGGCTTGCCGCATCACCCACTCCAACCCCTTGCGCCGCCCCTACCACGTGCCCCTGGCCCTGCCGCCCCCC
GATCCCCCCGACGCCACCTTGGCCCGCCACTTTTACCTGGTTGCCCTCATCAAGAGCTTCGACTTTGTCCTCGAC
TTGGAGGCCGCCGCCAACTTTCCCCCCGACCTCCCTGTCCGCTACTCGTGGGGGCCTCCCGACTTTTGCTACTCG
CAGTACATTCACCGCTCCGGCACCATGCTGGCCCAAATCACCGACGACGGCAAACTCTTGGTCCTGGCCAACCGC
CTCTACAGCCGCGCCAAGCCCTCCCCCGATGCCGCGCCCCTCCACCGCACCCCCAGCGCCCCCACCCCGGCCCAA
ATGCTCGCCTCGTCGCTGACGGAGCCCCAGGCCATTGCCCCTTCGCCCCTTGCCCGCCCCGCCCTGCAGTGCCAC
CACTGGTCTCCCATGGCCCGTCCCCTCGACCCCCAGCCCTCTGTCTATACCACACGCCCCGAGTCCCTCAAGGAC
GACCTCGAGGCCTTTTGCAGCGATGCTGCCGCCCTCGCTGCCTTTTACCGCGAGACCCTTGACAGGACCATGCGC
CCGCCTGCCCCCGAGACCCCTCTATATTCCTGCCCTGGGCTTGCCGCCCGCCGTCTTGGGGGGCCCGGCCTCTTT
GTATAG
Transcript >OphauB2|1219
ATGTCTCGCAAGGCGGGCGTGGAAGCTGGCAAACGGATTGGTGTGGGCGGCATGGCCACAACGGCAGCGCGGCGT
GGGCGACGGCGAGGAGCAGAGGCCATGGGCGATGGGGCTGCAGGGTGCTGCCAGGTTGGCATCCACGAGGGCTAC
GCACGCGACCATGTGCTGCTCAATCTCGACGTGGTGGCGATTGAGGCGGGCGCGCTGGTGTCCATGACTGTGCTG
GGGGGCGGGATTGGCGCGTCGGGCAAGGGCTGGGAGCATGGCGAGGGGCCGTCGGAGCAGCAGGAGCCCTATGTC
TTTGTGGCCAAGGACATGGCGCCCGAGCTCAAGGCGCGTCACGGCGGCGTCGAGGTGGTGGTGGCCAAGCACATG
GCGGATGCGTTTGGCATCAAGAAGACGGCCCAAGTGTGCCTGGCGGCTATTGACAAGGTGCAGCGCGTCACCGAG
GCGACGCATGTGGAAATCACCTTCAAGGACTACTATCTGTCGCGCGCCGACATGTGGCGGCTGACGGTGGGGGAG
CTGGCGCAGCGGACCGTGTACCGCGGCCAGTCGATTCTCTTTCTCGGCACCATCAAGGCGCTGGTGACGGCCGTC
TATGTCGACGGGCGCAGCGTGCACTCGGCCTTTTTTGTCGGGCACACGCGGCCCATTTTCCGCAGCGAGTCGGCG
CGGCATGTGCTCTTTATCCAGATGGCGCGCGAAATGTGGGATTTCGACTCGGACGGGTCGGGGGAAATCATGTTT
AGCCGCGTCGTCAACGGCTTCCTGCCCGCCATGTTCAAGCGATGGGCGGCGCTCAAGGTCAAGCACCTGGTGAGC
ATTGTGCTCTTTGCGCGCGTCGAGTACGACACGGGCCTGACGACGGAGCTGGCCGACAGCGACTCGTACTACACG
GGCATGCAGGCGTCGGGCAGCCGGCGGCCCTACAAGGACTTTTACCGCGTCGTCGTCAGCCAGATGGCCAGCGGC
GAGTGGACCAAGATTCTCTACCAGCTCAAGCGAGAGTTCAACTTTTTCCGCCGCGACATTAGCCTGCATCACCAG
TCGGCCGACGTGGCTTGCCTCGACGAGAGCGACAGTCTGGACATTGTCAAGCACGTCAAGGCCGAGTCGTCGCTG
TGCGTGCACGGCAACATTCTCGAGGCCATCAACCTGGCGGCCTCGCAGTTTGCCCACGACTACATTGACCGCGAC
CTCTACCGCACCGGCATTTCCATTGCCGTCATCACGCCCGGCACTGGCGTCTTTGAAGTCGACTATGAGACGCTT
GGCCGCACCACCGAGGCGCTGGTGGTTAATGGCATAGGCATCGACCTGATTTGCATGTCGAGGATGCCGCTGCAC
TCGGTTCCTCTCTTCAAGTATCGCAACCCCCTCTTTTCTTGGGGCCCAGGCTCCTTTGCGCGCTCGGTGCACAGC
CGCGGCAGCACGCCCAACCTCGAGACGCCAGTCATTGGCAGCTACCAGTCTCTCGAGGGGTCTCTGTCGCCCACC
AAGGCACCACCTGCTGAAGAGTGGTGCTTTGCTCTGCCGCACTGGCTCCACGTGTCCTTTTGGACGGGCGCGTCG
GACGATGCCCTCTCCTACGCCGGCATTGCTCTTGCCGTGTCCAACCGAGTGGAGCAGGCTGACGAGGACGAGTTT
CGCATCCGATGCCGCATGTATGATTTGCAGATGCGCAGCGTGCTCCATGTCAATGAGATTGAAACGGCACCGCTG
CAGAGCGACGCCAGCTACAGGGTAGAGGCGGCGGCGGGCTCGAGCCCTGGGGCACGGCAGCACCACGTCTTGTAC
AAGGCGTGCCGGCGCGCGCCCGACAGCCTGGTGGACAATGTGATTGGCTTCCAGCGCTTTGCTCCGGACAGGCTT
GTGCGGGCGGGCGACTTGTCGCTATGGAGACAGCTGCAGGACTTTGACGACTCGAGGAGCCGCCTGGCGGTCAAG
GCGCCGCCGCAGCATGGGCGAGGCGTCATCAAGGGCAAGCTGGACGAGGTGGAGCGCCCAAGGCAGCAGCAGCAG
CAGCAGCAGCAGCAACAAGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAAGAGCAGCAGCAGCAACAAGAG
CAGCAGCAGCAGGCGGTGGTGGCGGCGGAGGACCCGAGTGGAAGAGGGGGAGAGGGCCAGAGCAGCAGCCAAGGG
GCGAGCAAGGCGGCGGCGAATGGGCTTGGCAAGGGTGGCCCTGGCAAGCCCAAGGCCCTCATGAGACACATCAGC
TTGGGGCTGCGCGGCTTCGGAATTGCGGCGGCCAAGCCAGTGGTGGCGCAGGTCAAGGCGGAAAACGTCAGCGCA
GTGCCGGCGGCAGCAGAGGCGTCGGCGTCGGCGTCGGCGTCGGCGTCGGGGGCCAGGGCCGGGTCGCTCTCGCCA
GCGCGCAGCATGCCCATTGCCAAGGGCGAGGGCAGCCAGCGGCACGGGGCCATGACGGGCAGGTGGAGCGACGAG
GGCCATGTGCGCGACCGCAACGCGCTGCGGGCCGAAGACGCGCACAAGCTCTACACCAACAAGCTGCGGGCGGGC
GTGGTGCCCGAGCTGGCGGCCAGAGTGTCGCCGGGCAGTGCCCTGGCGCCGTGGCTGAGCCTGCTGGACCCGTCG
TGCCCCGACAAGCACCCGCTCGACGACCGCATGCTCTACAGCCGCTGGCAGCACGTCTTCCCCACCACGTCGGAC
ATGAAGGAGCACAAGTGGAAGGCGCTCTGCTGCCCGGCGTCGGTGCCGCTGACGACGGAGTACTTCCCGCCCAGG
GCGCAGTTTGACCGCGAGTGGCAGCGCCACCCCTACAACCTGGACCAAAGCCTCGACGTGGAGGAGGAGGCGGGC
GACCGGGCGCGGCACGAGTTTGTCAAGGAGCTGATTAGCATGCGCTTCTCGCAGGGCTTCCAGCTCATTGTGGGC
CCGCTGGTGGCGCAGGCCTTTGGCCACAAGCCCCTCAAGCTGGCCGACGTGTTTTCGCGCGACGAGCCGCTCGAG
GACGGCGCCAGCGTCTTCATGTCGGTGGGCAACACCATCCACCAGCTGGCCTGCGTGCGCGGCAGCGAGGTGGAG
GTGACGATATACGTGCGCAAGGCGCTCGACACCACGCCGCCGCCCCTCTACCGCGCCGCCATTCGCACCCTGCTC
GACAGCACCTACCACACGCGCCGCATCCACTTCTTGCGCGCCCAGCCAGAGCGCAACTGGAACGCCATTGACTCG
TATGTCGCCGGCCACAAGGACGACATGACGGAGGGCATGCGCTTTTGGCGCGCGCGCTTTGTGCTGATTCCCCAG
CGGGCCGAGGCGCGCAGCCACAGCGGCGACAGCCCCGAGGAGCTGCGCATCGAGGGCATCAAGCGCCTGGCCCAG
CTGTGGCAAAAGAACCGCTGCTTGCCCCCCGCCGACGCCCGCCTGCCCCCCGCGCCCCTCGACATTGTCTACAAG
ACGGACGACGCCTCCCTCGTCATTGCCGCCGACGGCGACTTGCTGTCCCTGCCCGACGCCCGCCGCCCCCGCCGC
CGCCATGGCTTTGTCAAGACGCACCTCAACCTGCCCGCCCTGGCCGACGCCATGCAGCAGCCCGTCGACCAGGGC
GGCGTGCCCCTGCGCAACCGCCGCTGGCACCTGCGCACCCACTCCGCCTCCTTTATCGGCTCCGACATGACCACT
TGGCTGCTCGACAACTTTACAAACGTCGACGACCGCGACGACGCCGAGCGCCTCGGCAACGCCCTCATGGCCTCC
GACTCCCACAAGGGCCTCTTTGTCCACGTCGAGCGCCGCCACCGCTTCCGCGACGGCAACTACTTTTACCGCTTT
GCCCCCGACTTTGCCAAGCCCCTGCCCGGCTGGTTTGCCTCGCGCCGCTCTCTGCCCCCGACCGACGCCCCCGCC
CCCGTCTTGCTCAGCCACGTCATCAAGTACGACGTGGACCCCCGCCGCCGCTCCTACCGCCCCGAGCACATCCAC
CTCCACTATGACCGCCTGCACAACCCCGACAACTGCTTCCACCTGCGCATCGACTGGCTCAACAAGACGTCCAAG
CTGGTCCAGGACGCCCTCGAGGCCTGGGAGCGCGAGGCCAGCCAGTATGGCCTGCGCCTCGTCGAGCTGCCCCTG
CACGAGGCTTGCCGCATCACCCACTCCAACCCCTTGCGCCGCCCCTACCACGTGCCCCTGGCCCTGCCGCCCCCC
GATCCCCCCGACGCCACCTTGGCCCGCCACTTTTACCTGGTTGCCCTCATCAAGAGCTTCGACTTTGTCCTCGAC
TTGGAGGCCGCCGCCAACTTTCCCCCCGACCTCCCTGTCCGCTACTCGTGGGGGCCTCCCGACTTTTGCTACTCG
CAGTACATTCACCGCTCCGGCACCATGCTGGCCCAAATCACCGACGACGGCAAACTCTTGGTCCTGGCCAACCGC
CTCTACAGCCGCGCCAAGCCCTCCCCCGATGCCGCGCCCCTCCACCGCACCCCCAGCGCCCCCACCCCGGCCCAA
ATGCTCGCCTCGTCGCTGACGGAGCCCCAGGCCATTGCCCCTTCGCCCCTTGCCCGCCCCGCCCTGCAGTGCCAC
CACTGGTCTCCCATGGCCCGTCCCCTCGACCCCCAGCCCTCTGTCTATACCACACGCCCCGAGTCCCTCAAGGAC
GACCTCGAGGCCTTTTGCAGCGATGCTGCCGCCCTCGCTGCCTTTTACCGCGAGACCCTTGACAGGACCATGCGC
CCGCCTGCCCCCGAGACCCCTCTATATTCCTGCCCTGGGCTTGCCGCCCGCCGTCTTGGGGGGCCCGGCCTCTTT
GTATAG
Gene >OphauB2|1219
ATGTCTCGCAAGGCGGGCGTGGAAGCTGGCAAACGGATTGGTGTGGGCGGCATGGCCACAACGGCAGCGCGGCGT
GGGCGACGGCGAGGAGCAGAGGCCATGGGCGATGGGGCTGCAGGGTGCTGCCAGGTTGGCATCCACGAGGGCTAC
GCACGCGACCATGTGCTGCTCAATCTCGACGTGGTGGCGATTGAGGCGGGCGCGCTGGTGTCCATGACTGTGCTG
GGGGGCGGGATTGGCGCGTCGGGCAAGGGCTGGGAGCATGGCGAGGGGCCGTCGGAGCAGCAGGAGCCCTATGTC
TTTGTGGCCAAGGACATGGCGCCCGAGCTCAAGGCGCGTCACGGCGGCGTCGAGGTGGTGGTGGCCAAGCACATG
GCGGATGCGTTTGGCATCAAGAAGACGGCCCAAGTGTGCCTGGCGGCTGTAGGTGGCGGGCGGGCAGGCAGACAT
GGCAGAGCGAGCTGACGCGGAGCAGATTGACAAGGTGCAGCGCGTCACCGAGGCGACGCATGTGGAAATCACCTT
CAAGGACTACTATCTGTCGCGCGCCGACATGTGGCGGCTGACGGTGGGGGAGCTGGCGCAGCGGACCGTGTACCG
CGGCCAGTCGATTCTCTTTCTCGGCACCATCAAGGCGCTGGTGACGGCCGTCTATGTCGACGGGCGCAGCGTGCA
CTCGGCCTTTTTTGTCGGGCACACGCGGCCCATTTTCCGCAGCGAGTCGGCGCGGCATGTGCTCTTTATCCAGAT
GGCGCGCGAAATGTGGGATTTCGACTCGGACGGGTCGGGGGAAATCATGTTTAGCCGCGTCGTCAACGGCTTCCT
GCCCGCCATGTTCAAGCGATGGGCGGCGCTCAAGGTCAAGCACCTGGTGAGCATTGTGCTCTTTGCGCGCGTCGA
GTACGACACGGGCCTGACGACGGAGCTGGCCGACAGCGACTCGTACTACACGGGCATGCAGGCGTCGGGCAGCCG
GCGGCCCTACAAGGACTTTTACCGCGTCGTCGTCAGCCAGATGGCCAGCGGCGAGTGGACCAAGATTCTCTACCA
GCTCAAGCGAGAGTTCAACTTTTTCCGCCGCGACATTAGCCTGCATCACCAGTCGGCCGACGTGGCTTGCCTCGA
CGAGAGCGACAGTCTGGACATTGTCAAGCACGTCAAGGCCGAGTCGTCGCTGTGCGTGCACGGCAACATTCTCGA
GGCCATCAACCTGGCGGCCTCGCAGTTTGCCCACGACTACATTGACCGCGACCTCTACCGCACCGGCATTTCCAT
TGCCGTCATCACGCCCGGCACTGGCGTCTTTGAAGTCGACTATGAGACGCTTGGCCGCACCACCGAGGCGCTGGT
GGTTAATGGCATAGGCATCGACCTGATTTGCATGTCGAGGATGCCGCTGCACTCGGTTCCTCTCTTCAAGTATCG
CAACCCCCTCTTTTCTTGGGGCCCAGGCTCCTTTGCGCGCTCGGTGCACAGCCGCGGCAGCACGCCCAACCTCGA
GACGCCAGTCATTGGCAGCTACCAGTCTCTCGAGGGGTCTCTGTCGCCCACCAAGGCACCACCTGCTGAAGAGTG
GTGCTTTGCTCTGCCGCACTGGCTCCACGTGTCCTTTTGGACGGGCGCGTCGGACGATGCCCTCTCCTACGCCGG
CATTGCTCTTGCCGTGTCCAACCGAGTGGAGCAGGCTGACGAGGACGAGTTTCGCATCCGATGCCGCATGTATGA
TTTGCAGATGCGCAGCGTGCTCCATGTCAATGAGATTGAAACGGCACCGCTGCAGAGCGACGCCAGCTACAGGGT
AGAGGCGGCGGCGGGCTCGAGCCCTGGGGCACGGCAGCACCACGTCTTGTACAAGGCGTGCCGGCGCGCGCCCGA
CAGCCTGGTGGACAATGTGATTGGCTTCCAGCGCTTTGCTCCGGACAGGCTTGTGCGGGCGGGCGACTTGTCGCT
ATGGAGACAGCTGCAGGACTTTGACGACTCGAGGAGCCGCCTGGCGGTCAAGGCGCCGCCGCAGCATGGGCGAGG
CGTCATCAAGGGCAAGCTGGACGAGGTGGAGCGCCCAAGGCAGCAGCAGCAGCAGCAGCAGCAGCAACAAGAGCA
GCAGCAGCAGCAGCAGCAGCAGCAGCAACAAGAGCAGCAGCAGCAACAAGAGCAGCAGCAGCAGGCGGTGGTGGC
GGCGGAGGACCCGAGTGGAAGAGGGGGAGAGGGCCAGAGCAGCAGCCAAGGGGCGAGCAAGGCGGCGGCGAATGG
GCTTGGCAAGGGTGGCCCTGGCAAGCCCAAGGCCCTCATGAGACACATCAGCTTGGGGCTGCGCGGCTTCGGAAT
TGCGGCGGCCAAGCCAGTGGTGGCGCAGGTCAAGGCGGAAAACGTCAGCGCAGTGCCGGCGGCAGCAGAGGCGTC
GGCGTCGGCGTCGGCGTCGGCGTCGGGGGCCAGGGCCGGGTCGCTCTCGCCAGCGCGCAGCATGCCCATTGCCAA
GGGCGAGGGCAGCCAGCGGCACGGGGCCATGACGGGCAGGTGGAGCGACGAGGGCCATGTGCGCGACCGCAACGC
GCTGCGGGCCGAAGACGCGCACAAGCTCTACACCAACAAGCTGCGGGCGGGCGTGGTGCCCGAGCTGGCGGCCAG
AGTGTCGCCGGGCAGTGCCCTGGCGCCGTGGCTGAGCCTGCTGGACCCGTCGTGCCCCGACAAGCACCCGCTCGA
CGACCGCATGCTCTACAGCCGCTGGCAGCACGTCTTCCCCACCACGTCGGACATGAAGGAGCACAAGTGGAAGGC
GCTCTGCTGCCCGGCGTCGGTGCCGCTGACGACGGAGTACTTCCCGCCCAGGGCGCAGTTTGACCGCGAGTGGCA
GCGCCACCCCTACAACCTGGACCAAAGCCTCGACGTGGAGGAGGAGGCGGGCGACCGGGCGCGGCACGAGTTTGT
CAAGGAGCTGATTAGCATGCGCTTCTCGCAGGGCTTCCAGCTCATTGTGGGCCCGCTGGTGGCGCAGGCCTTTGG
CCACAAGCCCCTCAAGCTGGCCGACGTGTTTTCGCGCGACGAGCCGCTCGAGGACGGCGCCAGCGTCTTCATGTC
GGTGGGCAACACCATCCACCAGCTGGCCTGCGTGCGCGGCAGCGAGGTGGAGGTGACGATATACGTGCGCAAGGC
GCTCGACACCACGCCGCCGCCCCTCTACCGCGCCGCCATTCGCACCCTGCTCGACAGCACCTACCACACGCGCCG
CATCCACTTCTTGCGCGCCCAGCCAGAGCGCAACTGGAACGCCATTGACTCGTATGTCGCCGGCCACAAGGACGA
CATGACGGAGGGCATGCGCTTTTGGCGCGCGCGCTTTGTGCTGATTCCCCAGCGGGCCGAGGCGCGCAGCCACAG
CGGCGACAGCCCCGAGGAGCTGCGCATCGAGGGCATCAAGCGCCTGGCCCAGCTGTGGCAAAAGAACCGCTGCTT
GCCCCCCGCCGACGCCCGCCTGCCCCCCGCGCCCCTCGACATTGTCTACAAGACGGACGACGCCTCCCTCGTCAT
TGCCGCCGACGGCGACTTGCTGTCCCTGCCCGACGCCCGCCGCCCCCGCCGCCGCCATGGCTTTGTCAAGACGCA
CCTCAACCTGCCCGCCCTGGCCGACGCCATGCAGCAGCCCGTCGACCAGGGCGGCGTGCCCCTGCGCAACCGCCG
CTGGCACCTGCGCACCCACTCCGCCTCCTTTATCGGCTCCGACATGACCACTTGGCTGCTCGACAACTTTACAAA
CGTCGACGACCGCGACGACGCCGAGCGCCTCGGCAACGCCCTCATGGCCTCCGACTCCCACAAGGGCCTCTTTGT
CCACGTCGAGCGCCGCCACCGCTTCCGCGACGGCAACTACTTTTACCGCTTTGCCCCCGACTTTGCCAAGCCCCT
GCCCGGCTGGTTTGCCTCGCGCCGCTCTCTGCCCCCGACCGACGCCCCCGCCCCCGTCTTGCTCAGCCACGTCAT
CAAGTACGACGTGGACCCCCGCCGCCGCTCCTACCGCCCCGAGCACATCCACCTCCACTATGACCGCCTGCACAA
CCCCGACAACTGCTTCCACCTGCGCATCGACTGGCTCAACAAGACGTCCAAGCTGGTCCAGGACGCCCTCGAGGC
CTGGGAGCGCGAGGCCAGCCAGTATGGCCTGCGCCTCGTCGAGCTGCCCCTGCACGAGGCTTGCCGCATCACCCA
CTCCAACCCCTTGCGCCGCCCCTACCACGTGCCCCTGGCCCTGCCGCCCCCCGATCCCCCCGACGCCACCTTGGC
CCGCCACTTTTACCTGGTTGCCCTCATCAAGAGCTTCGACTTTGTCCTCGACTTGGAGGCCGCCGCCAACTTTCC
CCCCGACCTCCCTGTCCGCTACTCGTGGGGGCCTCCCGACTTTTGCTACTCGCAGTACATTCACCGCTCCGGCAC
CATGCTGGCCCAAATCACCGACGACGGCAAACTCTTGGTCCTGGCCAACCGCCTCTACAGCCGCGCCAAGCCCTC
CCCCGATGCCGCGCCCCTCCACCGCACCCCCAGCGCCCCCACCCCGGCCCAAATGCTCGCCTCGTCGCTGACGGA
GCCCCAGGCCATTGCCCCTTCGCCCCTTGCCCGCCCCGCCCTGCAGTGCCACCACTGGTCTCCCATGGCCCGTCC
CCTCGACCCCCAGCCCTCTGTCTATACCACACGCCCCGAGTCCCTCAAGGACGACCTCGAGGCCTTTTGCAGCGA
TGCTGCCGCCCTCGCTGCCTTTTACCGCGAGACCCTTGACAGGACCATGCGCCCGCCTGCCCCCGAGACCCCTCT
AGTCTCATCCTCGTCGCCTCTGGTGCCCGTTGCAGACGCCAGTATTCCTGCCCTGGGCTTGCCGCCCGCCGTCTT
GGGGGGCCCGGCCTCTTTGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail