Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1211
Gene name
LocationContig_13:78372..78888
Strand-
Gene length (bp)516
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01096 TFIIS_C Transcription factor S-II (TFIIS) 3.6E-14 83 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32529|RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA12 PE=1 SV=1 1 122 2.0E-22
sp|O94703|RPA12_SCHPO DNA-directed RNA polymerase I subunit RPA12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa12 PE=3 SV=1 1 122 2.0E-17
sp|Q07271|TFS_SULAC Transcription factor S OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tfs PE=3 SV=2 7 120 1.0E-10
sp|Q5TM50|RPA12_MACMU DNA-directed RNA polymerase I subunit RPA12 OS=Macaca mulatta GN=ZNRD1 PE=3 SV=1 7 112 6.0E-09
sp|Q1XHV8|RPA12_PANTR DNA-directed RNA polymerase I subunit RPA12 OS=Pan troglodytes GN=ZNRD1 PE=3 SV=1 7 112 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32529|RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA12 PE=1 SV=1 1 122 2.0E-22
sp|O94703|RPA12_SCHPO DNA-directed RNA polymerase I subunit RPA12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa12 PE=3 SV=1 1 122 2.0E-17
sp|Q07271|TFS_SULAC Transcription factor S OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tfs PE=3 SV=2 7 120 1.0E-10
sp|Q5TM50|RPA12_MACMU DNA-directed RNA polymerase I subunit RPA12 OS=Macaca mulatta GN=ZNRD1 PE=3 SV=1 7 112 6.0E-09
sp|Q1XHV8|RPA12_PANTR DNA-directed RNA polymerase I subunit RPA12 OS=Pan troglodytes GN=ZNRD1 PE=3 SV=1 7 112 8.0E-09
sp|Q9P1U0|RPA12_HUMAN DNA-directed RNA polymerase I subunit RPA12 OS=Homo sapiens GN=ZNRD1 PE=2 SV=1 7 112 8.0E-09
sp|Q6MFY5|RPA12_RAT DNA-directed RNA polymerase I subunit RPA12 OS=Rattus norvegicus GN=Znrd1 PE=3 SV=1 7 112 2.0E-08
sp|Q791N7|RPA12_MOUSE DNA-directed RNA polymerase I subunit RPA12 OS=Mus musculus GN=Znrd1 PE=1 SV=1 7 112 1.0E-07
sp|Q58548|TFS_METJA Transcription factor S OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tfs PE=3 SV=1 9 122 1.0E-07
sp|Q56254|TFS_THECE Transcription factor S OS=Thermococcus celer GN=tfs PE=1 SV=1 7 119 2.0E-06
sp|Q1RMP0|RPA12_BOVIN DNA-directed RNA polymerase I subunit RPA12 OS=Bos taurus GN=ZNRD1 PE=2 SV=1 7 112 2.0E-06
sp|Q9P9I8|TFS_METTL Transcription factor S OS=Methanothermococcus thermolithotrophicus GN=tfs PE=3 SV=1 9 122 7.0E-06
sp|P07273|TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DST1 PE=1 SV=4 35 118 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0009059 macromolecule biosynthetic process No
GO:0046872 metal ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044249 cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Transcription factor TFIIS

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1211
MSAIGTLVFCTDCGNLLPPTKANPKNLVKCDCCGVVNKDIGAKKAVSCSKPTDFPSFLRQKLQSNVQSVQRHTIS
SGTAASESCPKCGGSEVKYTAVQLRSADEGSTIIYTCACGNSWHENN*
Coding >OphauB2|1211
ATGTCGGCAATAGGAACTCTCGTCTTCTGTACGGATTGCGGAAATCTTTTGCCGCCAACAAAGGCGAATCCTAAA
AATCTAGTCAAATGCGACTGCTGTGGGGTGGTGAACAAAGACATTGGCGCGAAAAAGGCTGTGAGCTGCTCAAAG
CCTACAGATTTCCCCTCCTTCCTTCGACAGAAATTGCAGTCCAATGTGCAGTCTGTTCAACGACACACCATCTCG
AGTGGCACGGCCGCTTCTGAATCATGTCCAAAGTGCGGCGGATCAGAAGTCAAATACACTGCCGTCCAGCTTCGG
AGTGCTGATGAAGGCTCTACCATTATATACACTTGCGCCTGCGGTAATTCGTGGCACGAGAATAACTGA
Transcript >OphauB2|1211
ATGTCGGCAATAGGAACTCTCGTCTTCTGTACGGATTGCGGAAATCTTTTGCCGCCAACAAAGGCGAATCCTAAA
AATCTAGTCAAATGCGACTGCTGTGGGGTGGTGAACAAAGACATTGGCGCGAAAAAGGCTGTGAGCTGCTCAAAG
CCTACAGATTTCCCCTCCTTCCTTCGACAGAAATTGCAGTCCAATGTGCAGTCTGTTCAACGACACACCATCTCG
AGTGGCACGGCCGCTTCTGAATCATGTCCAAAGTGCGGCGGATCAGAAGTCAAATACACTGCCGTCCAGCTTCGG
AGTGCTGATGAAGGCTCTACCATTATATACACTTGCGCCTGCGGTAATTCGTGGCACGAGAATAACTGA
Gene >OphauB2|1211
ATGTCGGCAATAGGAACTCTCGTCTTCTGTACGGATTGCGGAAATCTTTTGCCGCCAACAAAGGCGAATCCTAAA
AATCTAGTCAAATGCGACTGCTGTGGGGTGGTGAACAAAGGTTAGGACTATTATCACCATCAGGCTGCCTCCTCA
AAAACTCGACAAGGTAGCACTACTAACTACATCGACAATGACAGACATTGGCGCGAAAAAGGCTGTGAGCTGCTC
AAAGCCTACAGATTTCCCCTCCTTCCTTCGACAGAAATTGCAGTCCAATGTGCAGTCTGTTCAACGACACACCAT
CTCGAGTGGCACGGCCGCTTCTGAATCATGTCCAAAGTGCGGCGGATCAGAAGTCAAATACACTGCCGTCCAGCT
TCGGAGTGCTGATGAAGGCTCTACCATTATATACACTTGCGCCTGCGGTAATTCGTATGTCCAGCAATCTTCAAA
GTATGGTATTGGACATATTCCCGCTGATATTTATCGTCTGCGTCTAGGTGGCACGAGAATAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail