Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1208
Gene name
LocationContig_13:74599..75227
Strand+
Gene length (bp)628
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 4.2E-20 17 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13808|GMF1_SCHPO Actin-depolymerizing factor gmf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmf1 PE=3 SV=1 1 132 5.0E-22
sp|Q12156|AIM7_YEAST Protein AIM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM7 PE=1 SV=1 5 141 2.0E-20
sp|Q63228|GMFB_RAT Glia maturation factor beta OS=Rattus norvegicus GN=Gmfb PE=1 SV=2 11 134 3.0E-17
sp|Q5R6P6|GMFB_PONAB Glia maturation factor beta OS=Pongo abelii GN=GMFB PE=2 SV=3 11 134 7.0E-17
sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens GN=GMFB PE=1 SV=2 11 134 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13808|GMF1_SCHPO Actin-depolymerizing factor gmf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmf1 PE=3 SV=1 1 132 5.0E-22
sp|Q12156|AIM7_YEAST Protein AIM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM7 PE=1 SV=1 5 141 2.0E-20
sp|Q63228|GMFB_RAT Glia maturation factor beta OS=Rattus norvegicus GN=Gmfb PE=1 SV=2 11 134 3.0E-17
sp|Q5R6P6|GMFB_PONAB Glia maturation factor beta OS=Pongo abelii GN=GMFB PE=2 SV=3 11 134 7.0E-17
sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens GN=GMFB PE=1 SV=2 11 134 7.0E-17
sp|P60984|GMFB_BOVIN Glia maturation factor beta OS=Bos taurus GN=GMFB PE=1 SV=2 11 134 7.0E-17
sp|Q9CQI3|GMFB_MOUSE Glia maturation factor beta OS=Mus musculus GN=Gmfb PE=1 SV=3 11 134 9.0E-17
sp|Q56JZ9|GMFG_BOVIN Glia maturation factor gamma OS=Bos taurus GN=GMFG PE=2 SV=1 13 140 3.0E-15
sp|Q9ERL7|GMFG_MOUSE Glia maturation factor gamma OS=Mus musculus GN=Gmfg PE=1 SV=1 15 140 6.0E-15
sp|O60234|GMFG_HUMAN Glia maturation factor gamma OS=Homo sapiens GN=GMFG PE=1 SV=1 18 134 1.0E-14
sp|Q80T18|GMFG_RAT Glia maturation factor gamma OS=Rattus norvegicus GN=Gmfg PE=2 SV=1 15 140 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1208
MASESRLYKFSDDTKSHLRKFRLTTSRTKEPQAVIYLIDKNTHEIRQDQDATIYRSLDDVAEDLPDHAPRFVLLS
YPMTLPDGRMSVPYVLLYYLPLTCNAEVRMLYAGAKELMRNTSEVGKVLDIESPEDLQEVPHKLKQQ*
Coding >OphauB2|1208
ATGGCATCAGAGTCGAGGCTATACAAATTCTCCGACGACACAAAAAGCCACCTGCGCAAATTCCGTCTTACCACG
TCGCGCACCAAAGAGCCCCAAGCTGTCATTTACTTGATCGACAAGAACACGCATGAAATCCGTCAGGACCAAGAT
GCCACTATCTACCGGTCTCTCGATGACGTGGCCGAGGACCTGCCCGACCATGCCCCGCGTTTCGTGCTTCTAAGC
TATCCCATGACGCTGCCCGATGGCCGCATGTCTGTGCCCTATGTCCTCCTCTATTACCTTCCCTTAACATGCAAC
GCCGAGGTGCGCATGCTGTATGCAGGCGCCAAGGAGTTGATGCGCAACACGAGCGAGGTTGGCAAGGTGCTAGAC
ATAGAGTCCCCTGAAGACTTGCAAGAGGTGCCCCACAAGTTGAAGCAGCAATAA
Transcript >OphauB2|1208
ATGGCATCAGAGTCGAGGCTATACAAATTCTCCGACGACACAAAAAGCCACCTGCGCAAATTCCGTCTTACCACG
TCGCGCACCAAAGAGCCCCAAGCTGTCATTTACTTGATCGACAAGAACACGCATGAAATCCGTCAGGACCAAGAT
GCCACTATCTACCGGTCTCTCGATGACGTGGCCGAGGACCTGCCCGACCATGCCCCGCGTTTCGTGCTTCTAAGC
TATCCCATGACGCTGCCCGATGGCCGCATGTCTGTGCCCTATGTCCTCCTCTATTACCTTCCCTTAACATGCAAC
GCCGAGGTGCGCATGCTGTATGCAGGCGCCAAGGAGTTGATGCGCAACACGAGCGAGGTTGGCAAGGTGCTAGAC
ATAGAGTCCCCTGAAGACTTGCAAGAGGTGCCCCACAAGTTGAAGCAGCAATAA
Gene >OphauB2|1208
ATGGTGCGTTGAGATGCGCTCTTCTTCCTTTCTCCTCTTCTCTTCATGCTGACACACCCGTTAATTTCAAGGCAT
CAGAGTCGAGGCTATACAAATTCTCCGACGACACAAAAAGCCACCTGCGCAAATTCCGTCTTACCACGTCGCGCA
CCAAAGAGCCCCAAGCTGTCATTTGTCCGTCCCTTGTCCCTCTGTCCGGCCCAGGGCGCTAATCGTCTCTCTTGT
CCAGACTTGATCGACAAGAACACGCATGAAATCCGTCAGGACCAAGATGCCACTATCTACCGGTCTCTCGATGAC
GTGGCCGAGGACCTGCCCGACCATGCCCCGCGTTTCGTGCTTCTAAGCTATCCCATGACGCTGGTGCGCTCTTAT
TTCCTCTCGGTCCCTGTCAAGCCATACGTGCACATGGCAGCGACAACTGACAACTAGATACTAGCCCGATGGCCG
CATGTCTGTGCCCTATGTCCTCCTCTATTACCTTCCCTTAACATGCAACGCCGAGGTGCGCATGCTGTATGCAGG
CGCCAAGGAGTTGATGCGCAACACGAGCGAGGTTGGCAAGGTGCTAGACATAGAGTCCCCTGAAGACTTGCAAGA
GGTGCCCCACAAGTTGAAGCAGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail