Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1200
Gene name
LocationContig_13:51554..54429
Strand+
Gene length (bp)2875
Transcript length (bp)2694
Coding sequence length (bp)2694
Protein length (aa) 898

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17781 RPN1_RPN2_N RPN1 N-terminal domain 3.1E-115 55 354
PF18051 RPN1_C 26S proteasome non-ATPase regulatory subunit RPN1 C-terminal 1.2E-28 840 893
PF01851 PC_rep Proteasome/cyclosome repeat 1.1E-06 484 515
PF01851 PC_rep Proteasome/cyclosome repeat 2.7E-04 711 739

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87048|RPN1_SCHPO 26S proteasome regulatory subunit rpn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn1 PE=1 SV=2 6 892 0.0E+00
sp|Q4FZT9|PSMD2_RAT 26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus GN=Psmd2 PE=1 SV=1 32 894 0.0E+00
sp|Q8VDM4|PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus GN=Psmd2 PE=1 SV=1 32 894 0.0E+00
sp|P56701|PSMD2_BOVIN 26S proteasome non-ATPase regulatory subunit 2 OS=Bos taurus GN=PSMD2 PE=1 SV=2 32 894 0.0E+00
sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens GN=PSMD2 PE=1 SV=3 32 894 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87048|RPN1_SCHPO 26S proteasome regulatory subunit rpn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn1 PE=1 SV=2 6 892 0.0E+00
sp|Q4FZT9|PSMD2_RAT 26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus GN=Psmd2 PE=1 SV=1 32 894 0.0E+00
sp|Q8VDM4|PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus GN=Psmd2 PE=1 SV=1 32 894 0.0E+00
sp|P56701|PSMD2_BOVIN 26S proteasome non-ATPase regulatory subunit 2 OS=Bos taurus GN=PSMD2 PE=1 SV=2 32 894 0.0E+00
sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens GN=PSMD2 PE=1 SV=3 32 894 0.0E+00
sp|Q5R9I6|PSMD2_PONAB 26S proteasome non-ATPase regulatory subunit 2 OS=Pongo abelii GN=PSMD2 PE=2 SV=1 32 894 0.0E+00
sp|Q6XJG8|PSD2B_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog B OS=Arabidopsis thaliana GN=RPN1B PE=1 SV=1 44 893 0.0E+00
sp|Q54BC6|PSMD2_DICDI 26S proteasome non-ATPase regulatory subunit 2 OS=Dictyostelium discoideum GN=psmD2 PE=1 SV=1 44 892 0.0E+00
sp|Q9SIV2|PSD2A_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog A OS=Arabidopsis thaliana GN=RPN1A PE=1 SV=2 44 893 0.0E+00
sp|Q7S8R8|RPN1_NEUCR 26S proteasome regulatory subunit rpn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpn-1 PE=3 SV=2 1 897 0.0E+00
sp|P38764|RPN1_YEAST 26S proteasome regulatory subunit RPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN1 PE=1 SV=3 48 618 2.0E-163
sp|Q6FPV6|RPN1_CANGA 26S proteasome regulatory subunit RPN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN1 PE=3 SV=1 12 618 3.0E-162
sp|P38764|RPN1_YEAST 26S proteasome regulatory subunit RPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN1 PE=1 SV=3 633 893 2.0E-102
sp|Q6FPV6|RPN1_CANGA 26S proteasome regulatory subunit RPN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN1 PE=3 SV=1 633 893 3.0E-99
sp|Q8SS65|RPN1_ENCCU 26S proteasome regulatory subunit RPN1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN1 PE=1 SV=1 54 890 7.0E-72
sp|P32565|RPN2_YEAST 26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN2 PE=1 SV=4 282 830 5.0E-15
sp|Q3TXS7|PSMD1_MOUSE 26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1 365 832 6.0E-15
sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2 365 832 6.0E-15
sp|Q5R5S4|PSMD1_PONAB 26S proteasome non-ATPase regulatory subunit 1 OS=Pongo abelii GN=PSMD1 PE=2 SV=1 365 832 6.0E-15
sp|O88761|PSMD1_RAT 26S proteasome non-ATPase regulatory subunit 1 OS=Rattus norvegicus GN=Psmd1 PE=1 SV=1 365 832 7.0E-15
sp|Q5F418|PSMD1_CHICK 26S proteasome non-ATPase regulatory subunit 1 OS=Gallus gallus GN=PSMD1 PE=2 SV=1 365 832 2.0E-14
sp|Q54JM5|PSMD1_DICDI 26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1 375 737 1.0E-13
sp|Q9MAT0|PSD1B_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog B OS=Arabidopsis thaliana GN=RPN2B PE=1 SV=1 377 825 7.0E-13
sp|Q75CF3|RPN2_ASHGO 26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN2 PE=3 SV=1 347 820 1.0E-12
sp|Q18115|PSMD1_CAEEL 26S proteasome non-ATPase regulatory subunit 1 OS=Caenorhabditis elegans GN=rpn-2 PE=3 SV=4 363 825 2.0E-12
sp|O48844|PSD1A_ARATH 26S proteasome non-ATPase regulatory subunit 1 homolog A OS=Arabidopsis thaliana GN=RPN2A PE=1 SV=1 377 825 9.0E-12
sp|O74762|RPN2_SCHPO 26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn2 PE=1 SV=1 365 832 6.0E-10
sp|Q6FIP2|RPN2_CANGA 26S proteasome regulatory subunit RPN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN2 PE=3 SV=1 445 823 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1200
MPTDKESPKVGDKGKEKAVEEAKSTQKHANSKKDDDKQDADEELSEEDQQLQMELEMLVERLTESNAELYKSTLE
AMKTSIKTSTSSMTAVPKPLKFLRPHYATLTKLYDTWPETENRTSLADVLSVIGMTFSDDDKQDTLKYRLLAPTS
NIESWGHEYVRHLALQIGEVYTKRVVAEEAVKDLIDLALLLVPIFIKSNAEADAVDLMSELEIIEQISNFIDENT
YSRVCLYMVSMVNLLTYPDNETFLRTAHKIYVEYKQFSQALILAIRLRDFELMRADLDEPQNSSLRSQLAFLLGR
QRIVLDLPDENDEDEEVIECMSNQKLSEHYQNLAVQLNVLEPKNPDDIYKTHLESNRVAGMTNIDSARHNLSAAL
VNGFVNAGCARDNMMMVDGEKDAWVWKTKGDGMMSTVASMGMLMLWGIETGLDKIDRYTYSAEPEIAAGALLAIG
IMNSGVRLDSEPGLALLGDSEKLTHPHPLIKVASIMGLGLAYAGSNKEDVLQLLLPIISDTTQDMQISAMAALSC
GLVSVGSSNPDVSEAIMTTLLDDERQSQLTNKWTRFMALGLGLLFYGKQEEVDVILETLKAVDHPMARPTAVLAE
ICAWAGTGAVLKIQELLHICSEQKEESEDKKGDELLQAYAVLGIALVAMGEDVGQEMVMRQFGHLMHYGEANIRK
AVPLAMGLVSPSNPQMKVYDALSRYSHDTDPEVAMNAIFAMGMLGAGTNNARLAQLLRQLASYYHRDQDALFVVR
IAQGLLHMGKGMLSINPFHTDRQIMSHVAAAGLLTTVVAMIDPKDFIVSTSHYLLYFLSLATHPRCLIALDESLK
PLKVNVRVGQAVDVVGQAGRPKTITGWQTQSTPVLLGYGDRAELEDEEYISLSSTLEGLVILCKNPDWDADK*
Coding >OphauB2|1200
ATGCCCACAGACAAAGAATCGCCCAAGGTGGGAGATAAGGGCAAAGAAAAGGCTGTTGAAGAAGCCAAGAGCACT
CAGAAGCATGCAAATAGCAAGAAAGATGACGACAAGCAAGACGCCGACGAGGAGTTGAGTGAAGAGGACCAGCAG
CTCCAGATGGAGCTTGAAATGCTTGTAGAGCGCTTAACAGAGTCTAATGCGGAGCTATACAAATCGACTCTCGAA
GCCATGAAGACATCTATCAAAACTTCCACATCCTCCATGACGGCTGTACCGAAACCGTTAAAGTTTCTTCGTCCT
CATTATGCCACGCTAACTAAGCTATACGATACTTGGCCCGAGACTGAGAATCGAACTTCGTTGGCCGATGTGCTG
TCAGTCATTGGCATGACTTTTTCCGACGATGACAAACAAGACACGCTCAAGTACAGACTTTTGGCTCCCACTTCG
AATATCGAGTCTTGGGGCCACGAGTACGTGAGGCATCTGGCGCTACAGATTGGCGAGGTCTACACCAAGCGCGTC
GTCGCTGAAGAAGCTGTCAAAGACCTCATCGATCTGGCCCTCTTATTGGTGCCCATTTTTATCAAGTCCAACGCG
GAAGCTGATGCTGTTGATCTCATGAGCGAGCTTGAAATTATTGAGCAAATCTCTAATTTCATTGACGAAAACACC
TACTCCCGCGTCTGTCTTTACATGGTCAGCATGGTCAATCTCCTTACCTACCCCGATAACGAGACATTTCTACGA
ACTGCCCACAAGATATACGTCGAGTATAAACAATTTTCACAGGCACTCATTCTTGCCATTCGTCTACGCGACTTT
GAACTCATGAGGGCCGACTTGGACGAGCCTCAAAATTCAAGCTTGCGGAGCCAACTTGCTTTTCTACTTGGTCGG
CAAAGAATCGTCTTGGATCTTCCCGACGAAAACGATGAAGATGAAGAGGTTATTGAATGCATGTCGAACCAAAAG
CTGTCGGAACATTACCAAAACCTTGCTGTTCAACTGAATGTACTCGAACCGAAGAACCCAGACGATATATACAAG
ACACACCTCGAGAGCAACCGGGTGGCGGGCATGACGAATATTGACTCTGCCAGACACAATCTTTCGGCGGCTCTT
GTCAATGGGTTCGTCAACGCGGGTTGTGCTCGGGATAACATGATGATGGTGGATGGCGAAAAGGACGCATGGGTA
TGGAAGACCAAGGGAGATGGCATGATGTCTACTGTTGCCTCAATGGGCATGCTAATGCTGTGGGGCATTGAGACG
GGGCTGGATAAGATTGACAGATACACTTATTCGGCTGAGCCAGAAATTGCTGCTGGAGCGCTACTTGCGATTGGA
ATAATGAACTCGGGAGTACGGCTCGATTCAGAGCCCGGCTTGGCCCTCCTTGGAGACTCGGAGAAGCTGACGCAT
CCGCATCCTTTAATCAAGGTTGCCTCCATCATGGGCCTGGGACTTGCATATGCCGGGTCCAACAAGGAAGATGTA
TTGCAGCTGCTTCTGCCAATCATCAGCGACACGACGCAGGACATGCAAATTTCAGCCATGGCGGCTTTGTCGTGT
GGACTGGTGTCAGTAGGCTCTTCGAATCCCGACGTGTCCGAGGCCATCATGACGACGCTCTTGGATGATGAGCGG
CAGAGCCAGCTGACCAACAAGTGGACACGCTTCATGGCTTTGGGTCTGGGGCTCCTCTTTTACGGCAAACAAGAA
GAGGTGGATGTGATTCTGGAGACGCTCAAGGCTGTAGACCATCCTATGGCGCGGCCGACGGCAGTGCTGGCCGAG
ATTTGTGCTTGGGCTGGGACGGGGGCGGTGCTCAAGATTCAAGAACTTCTCCACATCTGCAGCGAACAAAAAGAG
GAGTCGGAGGATAAAAAGGGCGACGAGCTGCTGCAGGCATATGCGGTTCTGGGTATTGCGCTGGTGGCCATGGGG
GAGGACGTTGGACAGGAAATGGTGATGCGTCAGTTTGGCCACCTGATGCACTACGGCGAGGCGAATATTCGCAAG
GCGGTGCCTCTGGCCATGGGGCTGGTGAGCCCCAGCAATCCGCAGATGAAGGTGTACGATGCGCTGTCACGCTAT
AGCCACGACACGGATCCCGAGGTGGCGATGAATGCCATTTTTGCCATGGGCATGCTTGGAGCCGGCACCAACAAC
GCGCGGCTGGCGCAGCTGCTACGCCAGCTGGCCAGCTACTACCACCGCGACCAAGACGCCCTCTTTGTAGTGCGC
ATCGCTCAAGGCCTGCTGCACATGGGCAAAGGCATGTTGTCCATCAACCCCTTCCACACGGACCGGCAGATAATG
TCACACGTGGCGGCGGCAGGCCTGCTCACGACGGTTGTTGCCATGATTGACCCCAAGGACTTTATTGTGTCGACA
TCGCACTATCTTCTCTATTTCCTCTCCCTTGCCACGCACCCACGCTGTCTCATTGCTCTCGATGAATCGCTCAAG
CCGCTCAAGGTTAATGTGCGCGTCGGTCAGGCTGTCGACGTGGTGGGCCAGGCGGGCCGGCCAAAGACCATCACG
GGGTGGCAGACCCAGAGCACTCCGGTACTGCTGGGCTATGGCGACCGAGCAGAGCTCGAGGACGAGGAGTACATT
AGCCTGAGCAGCACGCTCGAGGGCTTGGTCATTCTGTGCAAGAACCCGGACTGGGACGCGGATAAATAG
Transcript >OphauB2|1200
ATGCCCACAGACAAAGAATCGCCCAAGGTGGGAGATAAGGGCAAAGAAAAGGCTGTTGAAGAAGCCAAGAGCACT
CAGAAGCATGCAAATAGCAAGAAAGATGACGACAAGCAAGACGCCGACGAGGAGTTGAGTGAAGAGGACCAGCAG
CTCCAGATGGAGCTTGAAATGCTTGTAGAGCGCTTAACAGAGTCTAATGCGGAGCTATACAAATCGACTCTCGAA
GCCATGAAGACATCTATCAAAACTTCCACATCCTCCATGACGGCTGTACCGAAACCGTTAAAGTTTCTTCGTCCT
CATTATGCCACGCTAACTAAGCTATACGATACTTGGCCCGAGACTGAGAATCGAACTTCGTTGGCCGATGTGCTG
TCAGTCATTGGCATGACTTTTTCCGACGATGACAAACAAGACACGCTCAAGTACAGACTTTTGGCTCCCACTTCG
AATATCGAGTCTTGGGGCCACGAGTACGTGAGGCATCTGGCGCTACAGATTGGCGAGGTCTACACCAAGCGCGTC
GTCGCTGAAGAAGCTGTCAAAGACCTCATCGATCTGGCCCTCTTATTGGTGCCCATTTTTATCAAGTCCAACGCG
GAAGCTGATGCTGTTGATCTCATGAGCGAGCTTGAAATTATTGAGCAAATCTCTAATTTCATTGACGAAAACACC
TACTCCCGCGTCTGTCTTTACATGGTCAGCATGGTCAATCTCCTTACCTACCCCGATAACGAGACATTTCTACGA
ACTGCCCACAAGATATACGTCGAGTATAAACAATTTTCACAGGCACTCATTCTTGCCATTCGTCTACGCGACTTT
GAACTCATGAGGGCCGACTTGGACGAGCCTCAAAATTCAAGCTTGCGGAGCCAACTTGCTTTTCTACTTGGTCGG
CAAAGAATCGTCTTGGATCTTCCCGACGAAAACGATGAAGATGAAGAGGTTATTGAATGCATGTCGAACCAAAAG
CTGTCGGAACATTACCAAAACCTTGCTGTTCAACTGAATGTACTCGAACCGAAGAACCCAGACGATATATACAAG
ACACACCTCGAGAGCAACCGGGTGGCGGGCATGACGAATATTGACTCTGCCAGACACAATCTTTCGGCGGCTCTT
GTCAATGGGTTCGTCAACGCGGGTTGTGCTCGGGATAACATGATGATGGTGGATGGCGAAAAGGACGCATGGGTA
TGGAAGACCAAGGGAGATGGCATGATGTCTACTGTTGCCTCAATGGGCATGCTAATGCTGTGGGGCATTGAGACG
GGGCTGGATAAGATTGACAGATACACTTATTCGGCTGAGCCAGAAATTGCTGCTGGAGCGCTACTTGCGATTGGA
ATAATGAACTCGGGAGTACGGCTCGATTCAGAGCCCGGCTTGGCCCTCCTTGGAGACTCGGAGAAGCTGACGCAT
CCGCATCCTTTAATCAAGGTTGCCTCCATCATGGGCCTGGGACTTGCATATGCCGGGTCCAACAAGGAAGATGTA
TTGCAGCTGCTTCTGCCAATCATCAGCGACACGACGCAGGACATGCAAATTTCAGCCATGGCGGCTTTGTCGTGT
GGACTGGTGTCAGTAGGCTCTTCGAATCCCGACGTGTCCGAGGCCATCATGACGACGCTCTTGGATGATGAGCGG
CAGAGCCAGCTGACCAACAAGTGGACACGCTTCATGGCTTTGGGTCTGGGGCTCCTCTTTTACGGCAAACAAGAA
GAGGTGGATGTGATTCTGGAGACGCTCAAGGCTGTAGACCATCCTATGGCGCGGCCGACGGCAGTGCTGGCCGAG
ATTTGTGCTTGGGCTGGGACGGGGGCGGTGCTCAAGATTCAAGAACTTCTCCACATCTGCAGCGAACAAAAAGAG
GAGTCGGAGGATAAAAAGGGCGACGAGCTGCTGCAGGCATATGCGGTTCTGGGTATTGCGCTGGTGGCCATGGGG
GAGGACGTTGGACAGGAAATGGTGATGCGTCAGTTTGGCCACCTGATGCACTACGGCGAGGCGAATATTCGCAAG
GCGGTGCCTCTGGCCATGGGGCTGGTGAGCCCCAGCAATCCGCAGATGAAGGTGTACGATGCGCTGTCACGCTAT
AGCCACGACACGGATCCCGAGGTGGCGATGAATGCCATTTTTGCCATGGGCATGCTTGGAGCCGGCACCAACAAC
GCGCGGCTGGCGCAGCTGCTACGCCAGCTGGCCAGCTACTACCACCGCGACCAAGACGCCCTCTTTGTAGTGCGC
ATCGCTCAAGGCCTGCTGCACATGGGCAAAGGCATGTTGTCCATCAACCCCTTCCACACGGACCGGCAGATAATG
TCACACGTGGCGGCGGCAGGCCTGCTCACGACGGTTGTTGCCATGATTGACCCCAAGGACTTTATTGTGTCGACA
TCGCACTATCTTCTCTATTTCCTCTCCCTTGCCACGCACCCACGCTGTCTCATTGCTCTCGATGAATCGCTCAAG
CCGCTCAAGGTTAATGTGCGCGTCGGTCAGGCTGTCGACGTGGTGGGCCAGGCGGGCCGGCCAAAGACCATCACG
GGGTGGCAGACCCAGAGCACTCCGGTACTGCTGGGCTATGGCGACCGAGCAGAGCTCGAGGACGAGGAGTACATT
AGCCTGAGCAGCACGCTCGAGGGCTTGGTCATTCTGTGCAAGAACCCGGACTGGGACGCGGATAAATAG
Gene >OphauB2|1200
ATGCCCACAGACAAAGAATCGCCCAAGGTGGGAGATAAGGGCAAAGAAAAGGCTGTTGAAGAAGCCAAGAGCACT
CAGAAGCATGCAAATAGCAAGAAAGATGACGACAAGCAAGACGGTAAGCTCGCTACTTCTTACTCTGGCGCAGCT
TCAATTTAGGCTGACGGCATAGCGGCAGCCGACGAGGAGTTGAGTGAAGAGGACCAGCAGCTCCAGATGGAGCTT
GAAATGCTTGTAGAGCGCTTAACAGTTCGTCTCTGGTCCCTGGCTCGATTTCATCGTTGATTGGGCAGCACCCGA
CTTATTTGACTTGGCAGGAGTCTAATGCGGAGCTATACAAATCGACTCTCGAAGCCATGAAGACATCTATCAAAA
CTTCCACATCCTCCATGACGGCTGTACCGAAACCGTTAAAGTTTCTTCGTCCTCATTATGCCACGCTAACTAAGC
TATACGATACTTGGCCCGAGACTGAGAATCGAACTTCGTTGGCCGATGTGCTGTCAGTCATTGGCATGACTTTTT
CCGACGATGACAAACAAGACACGCTCAAGTACAGACTTTTGGCTCCCACTTCGAATATCGAGTCTTGGGGCCACG
AGTACGTGAGGCATCTGGCGCTACAGATTGGCGAGGTCTACACCAAGCGCGTCGTCGCTGAAGAAGCTGTCAAAG
ACCTCATCGATCTGGCCCTCTTATTGGTGCCCATTTTTATCAAGTCCAACGCGGAAGCTGATGCTGTTGATCTCA
TGAGCGAGCTTGAAATTATTGAGCAAATCTCTAATTTCATTGACGAAAACACCTACTCCCGCGTCTGTCTTTACA
TGGTCAGCATGGTCAATCTCCTTACCTACCCCGATAACGAGACATTTCTACGAACTGCCCACAAGATATACGTCG
AGTATAAACAATTTTCACAGGCACTCATTCTTGCCATTCGTCTACGCGACTTTGAACTCATGAGGGCCGACTTGG
ACGAGCCTCAAAATTCAAGCTTGCGGAGCCAACTTGCTTTTCTACTTGGTCGGCAAAGAATCGTCTTGGATCTTC
CCGACGAAAACGATGAAGATGAAGAGGTTATTGAATGCATGTCGAACCAAAAGCTGTCGGAACATTACCAAAACC
TTGCTGTTCAACTGAATGTACTCGAACCGAAGAACCCAGACGATATATACAAGACACACCTCGAGAGCAACCGGG
TGGCGGGCATGACGAATATTGACTCTGCCAGACACAATCTTTCGGCGGCTCTTGTCAATGGGTTCGTCAACGCGG
GTTGTGCTCGGGATAACATGATGATGGTGGATGGCGAAAAGGACGCATGGGTATGGAAGACCAAGGGAGATGGCA
TGATGTCTACTGTTGCCTCAATGGGCATGCTAATGCTGTGGGGCATTGAGACGGGGCTGGATAAGATTGACAGAT
ACACTTATTCGGCTGAGCCAGAAATTGCTGCTGGAGCGCTACTTGCGATTGGAATAATGAACTCGGGAGTACGGC
TCGATTCAGAGCCCGGCTTGGCCCTCCTTGGAGACTCGGAGAAGCTGACGCATCCGCATCCTTTAATCAAGGTTG
CCTCCATCATGGGCCTGGGACTTGCATATGCCGGGTCCAACAAGGAAGATGTATTGCAGCTGCTTCTGCCAATCA
TCAGCGACACGACGCAGGACATGCAAATTTCAGCCATGGCGGCTTTGTCGTGTGGACTGGTGTCAGTAGGCTCTT
CGAATCCCGACGTGTCCGAGGCCATCATGACGACGCTCTTGGATGATGAGCGGCAGAGCCAGCTGACCAACAAGT
GGACACGCTTCATGGCTTTGGGTCTGGGGCTCCTCTTTTACGGCAAACAAGAAGAGGTGGATGTGATTCTGGAGA
CGCTCAAGGCTGTAGACCATCCTATGGCGCGGCCGACGGCAGTGCTGGCCGAGATTTGTGCTTGGGCTGGGACGG
GGGCGGTGCTCAAGATTCAAGAACTTCTCCACATCTGCAGCGAACAAAAAGAGGAGTCGGAGGATAAAAAGGGCG
ACGAGCTGCTGCAGGCATATGCGGTTCTGGGTATTGCGCTGGTGGCCATGGGGGAGGACGTTGGACAGGAAATGG
TGATGCGTCAGTTTGGCCACCTGATGCACTACGGCGAGGCGAATATTCGCAAGGCGGTGCCTCTGGCCATGGGGC
TGGTGAGCCCCAGCAATCCGCAGATGAAGGTGTACGATGCGCTGTCACGCTATAGCCACGACACGGATCCCGAGG
TGGCGATGAATGCCATTTTTGCCATGGGCATGCTTGGAGCCGGCACCAACAACGCGCGGCTGGCGCAGCTGCTAC
GCCAGCTGGCCAGCTACTACCACCGCGACCAAGACGCCCTCTTTGTAGTGCGCATCGCTCAAGGCCTGCTGCACA
TGGGCAAAGGCATGTTGTCCATCAACCCCTTCCACACGGACCGGCAGATAATGTCACACGTGGCGGCGGCAGGCC
TGCTCACGACGGTTGTTGCCATGATTGACCCCAAGGACTTTATTGTGTCGACATCGCACTATCTTCTCTATTTCC
TCTCCCTTGCCACGCACCCACGCTGTCTCATTGCTCTCGATGAATCGCTCAAGCCGCTCAAGGTTAATGTGCGCG
TCGGTCAGGCTGTCGACGTGGTGGGCCAGGCGGGCCGGCCAAAGACCATCACGGGGTGGCAGACCCAGAGCACTC
CGGTACTGCTGGGCTATGGCGACCGAGCAGAGCTCGAGGACGAGGAGTACATTAGCCTGAGCAGCACGCTCGAGG
GCTTGGTCATTCTGTGCAAGGTGAGAATGCACTCTTGAAGTAGTTGATTGTGCGCTGACGAGTCTTGTCATAGAA
CCCGGACTGGGACGCGGATAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail