Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1195
Gene name
LocationContig_13:31553..39442
Strand-
Gene length (bp)7889
Transcript length (bp)7485
Coding sequence length (bp)7485
Protein length (aa) 2495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14222 MOR2-PAG1_N Cell morphogenesis N-terminal 1.8E-217 357 941
PF14225 MOR2-PAG1_C Cell morphogenesis C-terminal 1.9E-90 1943 2193
PF14228 MOR2-PAG1_mid Cell morphogenesis central region 1.1E-17 1425 1697
PF14228 MOR2-PAG1_mid Cell morphogenesis central region 6.8E-11 1732 1893

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40468|TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAO3 PE=1 SV=1 222 2364 0.0E+00
sp|Q9HDV6|MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mor2 PE=4 SV=1 927 2385 2.0E-147
sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 227 1668 4.0E-61
sp|E9Q8I9|FRY_MOUSE Protein furry homolog OS=Mus musculus GN=Fry PE=1 SV=1 227 1689 2.0E-42
sp|Q5TBA9|FRY_HUMAN Protein furry homolog OS=Homo sapiens GN=FRY PE=1 SV=1 227 1689 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40468|TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAO3 PE=1 SV=1 222 2364 0.0E+00
sp|Q9HDV6|MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mor2 PE=4 SV=1 927 2385 2.0E-147
sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 227 1668 4.0E-61
sp|E9Q8I9|FRY_MOUSE Protein furry homolog OS=Mus musculus GN=Fry PE=1 SV=1 227 1689 2.0E-42
sp|Q5TBA9|FRY_HUMAN Protein furry homolog OS=Homo sapiens GN=FRY PE=1 SV=1 227 1689 3.0E-41
sp|Q9HDV6|MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mor2 PE=4 SV=1 218 796 3.0E-38
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 227 959 1.0E-36
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 1146 1668 4.0E-18
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 1819 1937 3.0E-11
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 1937 2194 9.0E-10
sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 1784 1931 5.0E-08
sp|E9Q8I9|FRY_MOUSE Protein furry homolog OS=Mus musculus GN=Fry PE=1 SV=1 1819 1946 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1195
MAPSQPPPDKVQDSLKLVARSVSRLDDDAEDRTVRPRPFSPKPSRFASHSREPSLEKQLPATLTSPRVRQITGGA
SSAPASSSPTSSPASAPTSASSSGIIERPIDPTKAALYGHHRQTSIVHGYQHSRNGSVASSAGPVSPQMIAAAAG
ADVQSVAARLESDGSTQPRAPTSLAESLASASSLSMERSASATDASPGPAAGLRKLERGHSKSHSSRHHREDQKT
VGECAFHVLLTSFVGQAEEKLAESLVEPLDVEPQIERICGPGVDQAFDQLIIALGHIARPKPKPLIDTVMLWRKH
KSEAVTEARTQLQQLRGNQSIGSLVRRNTEPVQSGPENASPTGATVSTLQKLVSQQERRSTVATYILCRVLLEVF
SKTTMSCIGSDMEDKLEGIMFTQLKITEWEQLVSSPLKLANWSLFAQLLGHMSAINFNVVTGRFLEELEKSVQDR
ALVRSPTSSASGRDPETKQYLVLGGMQHLRIKLQPDAAWEDSCEFLIALGRLFNRCRGLRIKMAFCQILQLLVLP
IAAQASSNHLTHPKWAEVMSTISQRLGQIFMKPRYWTVAFPLTATMLCLSSPDTFASQWSQLTLSLQTKFRDRPT
RPLCLQVISRLLWTYLFRATDSLQSSAKKLDDLVKLVMPPPAKRNAISFDPAVTEPMIQIIRIIGFRYPEYCFRS
VIFPLINADLFVANKELKVEQLEPDRIVVGIRAFLCIMSDLEKGDKGQPPFPQFYHGDPLTDKLPLYPILSLARN
SQTSNSDASLTEARPVLTQQLSEGVREYYSQFCQILGKITIICDNTFGGQAALDERFNSPGPKTPIADTFNFARR
DEHQIAADQKQAFYELLHVAVKALPRCLSVDIPINPLINLLCTGTAHVQNNIAQSSATSLKAIARHSHAQQVTMG
FARFIFNFDDRYSTMSDGGMLGPDHIENTLRLYVELLQIWIDEIKQKSRDAASSPAEASASDKRALKLDLSSIWA
EVDQAEAHGLFFLCSQSRRVRHYAVTALRLITEFDKALGKGTTEEKESPRLINILENYSSQVMDFNDEHLTVAER
SRLQRAFDKCPFTVAICRDLVGNRILEMYTAIVHLSEPNRGFYYLADQSNGRAPVRSPAAQPEVLIEQWKLYLIF
ACTTLADAGTQTPNPAKETQHARKTSKQPMDKIVTARTLFKYLLPLLSCSSASVRDAVVVAMGSINKHIYRPLVE
ELYGHVCRVHDDSRARIHSRSNSIPRRNRTIALMRTEATHVFKLTAHFLKEPPLPHVEYILDTLSAYTKDLKLLL
MDGEVQMDWEFQQLRRHYCGLIEIMFEGVSMTDNPLRWMTFEARKSAFSLMEDWCGFSPNQTQIKVREHTMRQSL
LDRQASVEPKIVSAAMERERHNLKTAALNSMATLCAGPLMVVTESGITLQFDMRRMLVWIEAIFNSGNDKMKMTG
RRALKNLLVHNREIPYLVENCISRCYLSQVPKVLESYFTVTIEVLQEHGDYPCPFWRTLGLCLFILGNDQSTIRT
KSSTMLRTLDTRQQRNSKIQDFDISISDKTQAVYKLAQFEISKRLAKQHADLAFYIFSDFAYYFKDLVPAAQRNV
IAVILPWIQAVELKLDPNGGPTAESYVLLANLLDLTIKSGGALHNEVQALWQALATGPYPGNVRLVLDFIMQLCL
ERREQNFVEYAKQIVVFLSTTNSTPGIKVVEFLLMQITPKAMVPHEIREAVPPPPEINSLPYCADLSSMLPVGPK
PAGFSLGQLSLILLVDLMVSPVQLKAESVPLILQVVTVLWDHYTPLVQDQAQEMLVHLVHELVISRLDDEQQGNV
KQSFQELVDLTRRHDRSVVWDYEDSNGNLDDQANKVPPGMEVLTTRIVETFETTFAGIKEQWGRLSLTWATSCPV
RHLARRSFQIFRCVLTSLDQRMLGDMLARLSNAVADEDAEIRSFSMEILTTLKTLIVKLDADDLIKFPQLFWTTC
ACLDSINEREFLEAVEMLNELVQKFDLRSGNVRRLLADEQPEGWDGPFEGIQPLLYKGLRSALCWQPTLDALGQL
VKLPTDALIGDDSRLFFTLLANFPRFLNEMERGTVSQEAIETALLLQEETDKQGLESLWLVLDGLISGQQRDGGE
FLKQLFAALKEHYLPRLEFKMITFLIGLLTNSLSWVKVQTMRILCVAIPEVDMRKPELAGHGSDLISPLLRLLQT
EFCMDALEVLDNIMTMSGSHTDRHHVRMSMTRFTSRAVRKEYERTQSLFGIPEASGWAIPVPARKAEATRCNVRA
AFRMCQSAEGSFAETTPTSEVEFHADDYPYGYFETDRADTMLSDDGRMDALGGDVVTKLDSLDDFFDEQSSPMTD
DDDGSSRTITEFTPEAFESSTELYDHQILPILNEASSGTTLFQNGFMERPIMGARDVAANTMNPGAFTAVMPPRP
GLHSRSVTSPSAPASYQALIAAGEIPSDDDYLSGGLSEGDEERSSARYSEKPFILESVIQSPRQGASGGARRLLS
KSRDEAVAPVTPRMPTKMF*
Coding >OphauB2|1195
ATGGCGCCGTCTCAGCCACCGCCGGACAAGGTGCAGGATTCGCTCAAGTTGGTCGCTCGATCCGTCTCGCGACTC
GACGACGACGCCGAGGACCGGACAGTGCGGCCTCGACCCTTCAGCCCCAAGCCATCGCGCTTTGCCTCCCATTCG
AGAGAGCCGTCGCTCGAGAAGCAACTCCCGGCGACTTTGACGTCTCCGCGCGTCCGTCAAATCACGGGCGGTGCA
TCCTCAGCCCCAGCATCCTCAAGCCCAACATCATCACCAGCATCCGCCCCAACCAGCGCATCATCAAGTGGCATT
ATTGAGCGTCCCATCGACCCGACAAAAGCAGCCCTATACGGCCATCATCGCCAGACATCTATTGTACACGGCTAC
CAACATTCGAGAAATGGCAGCGTTGCAAGCTCCGCCGGCCCTGTTAGCCCTCAGATGATTGCCGCCGCCGCCGGC
GCTGACGTGCAATCAGTAGCTGCCCGTTTAGAGTCCGACGGTTCGACGCAACCCCGGGCTCCGACGTCCTTGGCT
GAGTCTCTGGCAAGCGCCAGCAGTCTTTCAATGGAGAGATCGGCTTCTGCTACCGATGCCTCTCCTGGCCCGGCT
GCTGGCTTGCGCAAGCTCGAGCGAGGACACAGTAAATCGCACTCGTCGCGGCACCATCGCGAAGACCAAAAGACT
GTTGGCGAATGTGCCTTTCATGTCCTTTTGACCTCGTTTGTGGGACAAGCCGAAGAAAAGTTGGCCGAGTCTCTG
GTTGAGCCTCTAGATGTCGAGCCCCAGATTGAGCGAATATGTGGCCCTGGTGTTGACCAAGCCTTTGATCAGCTG
ATCATTGCCCTTGGACATATAGCCAGGCCCAAACCCAAGCCTCTGATTGACACGGTAATGTTGTGGAGGAAGCAC
AAGAGCGAAGCCGTCACCGAAGCCCGTACCCAGCTCCAACAACTGCGCGGAAACCAATCTATTGGCAGTCTGGTA
CGCAGGAACACAGAGCCAGTCCAGAGTGGCCCTGAAAATGCCTCCCCTACTGGAGCCACCGTCTCAACCTTGCAG
AAGCTTGTTTCACAGCAGGAGCGACGATCTACGGTTGCCACATACATCTTGTGCCGGGTGCTACTCGAAGTTTTT
TCCAAGACGACAATGTCATGTATAGGCAGCGATATGGAAGACAAGTTGGAGGGCATCATGTTTACCCAGCTCAAG
ATTACTGAGTGGGAGCAACTGGTCAGCTCACCTCTCAAACTGGCCAACTGGAGCCTTTTTGCGCAGTTGCTGGGC
CACATGAGCGCCATCAACTTCAATGTGGTCACTGGGCGCTTTCTTGAGGAGCTGGAAAAGTCGGTACAGGACCGC
GCACTTGTCCGGAGCCCTACGTCGTCGGCCAGCGGGCGCGATCCCGAGACCAAGCAATATCTTGTCCTTGGTGGC
ATGCAACACTTGCGTATAAAGCTTCAGCCAGATGCCGCCTGGGAGGACTCTTGTGAATTTCTCATTGCTCTGGGC
CGCCTGTTTAACCGATGTCGCGGCCTCCGCATTAAGATGGCCTTTTGCCAGATCCTTCAGCTGCTAGTACTTCCA
ATCGCTGCCCAAGCCAGTAGCAATCATCTAACACATCCCAAATGGGCCGAGGTCATGTCCACCATTAGTCAACGC
CTCGGTCAGATTTTTATGAAGCCACGATATTGGACCGTCGCTTTTCCACTGACTGCGACCATGCTCTGTCTTTCA
TCGCCCGATACATTTGCATCCCAATGGTCTCAACTGACCCTGTCGTTGCAAACAAAGTTCAGGGATCGGCCGACA
CGACCACTTTGTCTGCAAGTCATATCTCGCTTGCTGTGGACCTATCTTTTTCGCGCCACCGACAGTCTTCAGAGC
TCCGCCAAGAAGCTTGACGACTTGGTAAAGCTTGTTATGCCGCCTCCTGCCAAACGCAACGCCATATCATTTGAT
CCAGCAGTCACAGAGCCCATGATACAGATTATTCGAATAATAGGCTTCAGATACCCCGAGTATTGCTTCCGATCT
GTTATTTTCCCACTCATCAACGCCGACCTGTTTGTTGCCAACAAGGAGCTCAAGGTTGAACAGCTTGAACCTGAC
CGCATCGTCGTTGGCATTAGGGCCTTTCTCTGCATCATGTCCGACTTGGAAAAGGGCGACAAGGGCCAGCCTCCG
TTCCCACAATTCTACCACGGAGACCCTTTGACGGATAAACTTCCCCTCTATCCAATACTGTCTCTGGCACGCAAC
AGCCAGACGTCAAATTCTGATGCCTCGCTTACAGAGGCGCGTCCGGTGCTCACACAGCAACTGAGCGAAGGCGTG
CGCGAGTATTACTCACAGTTTTGCCAAATACTCGGAAAGATTACAATTATTTGCGATAACACTTTTGGGGGGCAG
GCGGCATTGGACGAGCGATTTAATAGCCCTGGACCCAAGACGCCAATCGCTGACACTTTTAATTTTGCGCGTCGT
GATGAGCACCAGATTGCCGCCGACCAGAAGCAGGCTTTTTACGAACTCCTGCACGTGGCTGTCAAGGCTCTTCCT
CGTTGTCTGTCGGTCGACATTCCAATCAACCCTCTTATCAATTTGTTGTGTACTGGCACAGCCCATGTTCAAAAT
AATATTGCACAGTCATCGGCAACTTCACTCAAGGCCATTGCTAGGCACTCGCATGCTCAACAAGTGACAATGGGC
TTTGCTCGCTTCATTTTCAACTTTGATGATCGATACTCAACCATGTCTGATGGTGGCATGCTTGGGCCCGATCAC
ATTGAGAATACGCTTCGACTGTACGTTGAATTATTACAGATTTGGATCGACGAGATCAAACAAAAGTCGCGCGAC
GCAGCGTCGAGTCCAGCCGAAGCAAGTGCATCAGATAAGCGAGCCCTCAAGCTGGATTTGTCGAGCATCTGGGCC
GAGGTGGACCAAGCAGAAGCTCATGGCCTTTTTTTCCTTTGTTCCCAGTCACGGCGCGTCCGTCATTACGCCGTT
ACGGCCCTGCGACTCATCACAGAGTTTGACAAGGCTCTCGGCAAGGGAACAACAGAAGAAAAGGAATCACCAAGG
CTCATAAACATACTCGAGAACTACTCGAGCCAAGTAATGGACTTTAATGATGAGCATTTGACTGTTGCTGAACGC
AGCAGACTTCAAAGGGCCTTTGACAAGTGCCCCTTTACCGTCGCCATCTGCCGTGACCTTGTGGGCAATCGCATT
CTCGAAATGTACACAGCCATTGTGCACCTCTCTGAGCCCAATCGTGGCTTTTATTACTTGGCTGATCAGTCCAAT
GGGCGAGCACCTGTGCGATCGCCAGCGGCCCAACCTGAAGTCTTGATTGAGCAGTGGAAGCTTTACCTCATCTTT
GCCTGCACGACTCTTGCCGATGCTGGCACCCAGACGCCCAATCCTGCAAAGGAAACTCAGCATGCAAGAAAGACT
TCCAAGCAACCGATGGATAAGATTGTGACGGCACGCACCTTGTTCAAGTATCTGCTTCCACTGCTTTCCTGCTCA
TCGGCTTCGGTCCGGGATGCCGTCGTGGTGGCCATGGGATCTATCAATAAGCACATTTATCGACCCCTGGTCGAG
GAGCTGTACGGCCATGTATGCAGGGTCCATGATGATTCGCGAGCCCGCATTCACAGTCGAAGTAATAGCATTCCG
AGACGCAATCGGACAATTGCCCTCATGCGTACGGAGGCAACGCATGTCTTTAAGTTGACAGCGCATTTCCTCAAG
GAACCCCCACTCCCACATGTCGAATACATTCTAGACACACTGTCCGCATACACAAAGGATTTGAAGCTCCTCCTC
ATGGATGGGGAGGTGCAGATGGATTGGGAGTTTCAGCAGCTCAGGCGACACTACTGTGGTCTCATAGAGATCATG
TTTGAGGGGGTGAGCATGACGGACAATCCACTTAGATGGATGACATTTGAAGCTAGAAAATCAGCCTTTTCGCTC
ATGGAAGACTGGTGCGGCTTCTCGCCCAATCAGACGCAGATAAAGGTCAGAGAGCACACGATGAGGCAATCGCTC
TTGGATCGCCAGGCAAGTGTTGAGCCCAAGATTGTTTCGGCTGCCATGGAAAGAGAGCGGCACAATCTCAAAACT
GCGGCGCTCAACTCTATGGCGACGCTTTGTGCCGGACCGCTCATGGTTGTGACTGAAAGCGGCATCACGTTGCAG
TTTGACATGCGTCGCATGCTTGTCTGGATTGAGGCTATTTTCAACTCTGGAAACGACAAGATGAAAATGACGGGT
CGCAGAGCCTTGAAGAACTTGTTGGTGCATAACCGAGAAATTCCATATCTCGTTGAGAACTGTATTTCTCGTTGC
TACCTGTCACAGGTTCCCAAGGTACTCGAGAGCTACTTTACAGTGACTATCGAGGTGCTACAAGAGCATGGTGAC
TATCCCTGTCCCTTTTGGAGAACTCTGGGCCTCTGTCTCTTCATCCTAGGCAACGATCAAAGTACCATACGGACC
AAGTCGTCAACCATGCTTCGGACTTTGGACACCCGTCAACAGCGCAATTCCAAGATTCAAGACTTTGACATTAGC
ATTTCGGACAAGACACAAGCCGTATATAAACTCGCACAATTTGAAATTTCCAAGCGCCTGGCCAAGCAACACGCC
GATCTTGCTTTTTACATCTTCTCCGACTTTGCATACTACTTTAAAGATCTTGTACCGGCAGCACAGCGGAACGTC
ATTGCCGTTATTCTCCCTTGGATCCAGGCTGTGGAGCTCAAATTGGACCCCAATGGCGGTCCTACGGCCGAGTCG
TACGTTCTTTTGGCCAACCTTTTGGACTTGACCATCAAATCGGGCGGCGCCCTGCACAATGAGGTCCAGGCCTTG
TGGCAGGCATTGGCCACTGGACCTTACCCAGGAAACGTGCGTCTAGTTTTGGATTTTATCATGCAGCTCTGTCTA
GAGAGACGCGAACAAAACTTTGTCGAGTACGCCAAGCAAATAGTTGTCTTTCTCTCCACCACAAACAGCACTCCA
GGCATCAAGGTTGTCGAGTTCCTGCTCATGCAAATCACTCCAAAAGCCATGGTGCCCCATGAGATAAGAGAAGCA
GTGCCACCACCGCCCGAGATAAATAGCCTGCCATATTGTGCTGACCTCAGCAGTATGCTGCCTGTCGGGCCCAAA
CCAGCTGGATTTTCTCTCGGACAGTTGTCGCTCATTCTGCTTGTTGACTTGATGGTGTCCCCGGTGCAACTCAAG
GCCGAGAGCGTACCTCTTATCCTCCAGGTTGTGACTGTTTTATGGGACCACTACACGCCTTTGGTGCAGGATCAA
GCACAAGAGATGCTTGTACACCTTGTACATGAACTCGTCATCTCTCGCTTGGATGATGAACAGCAGGGCAACGTG
AAACAATCTTTTCAAGAATTGGTCGATCTTACCCGGCGGCATGATCGCTCTGTCGTCTGGGACTATGAAGACAGC
AATGGAAACCTTGATGACCAAGCTAATAAGGTGCCGCCTGGCATGGAGGTTTTGACGACGCGAATTGTCGAGACG
TTTGAAACGACCTTTGCAGGAATTAAAGAACAATGGGGCCGCTTGTCCTTGACGTGGGCTACCTCGTGCCCAGTT
CGACACTTGGCCCGGCGGTCGTTTCAGATATTTCGCTGTGTGCTCACTTCATTGGATCAACGCATGCTCGGAGAC
ATGCTGGCCAGACTGTCAAATGCCGTTGCTGACGAGGATGCCGAGATTCGGTCGTTTTCAATGGAGATTTTGACG
ACGCTCAAGACTCTGATTGTGAAGCTTGACGCCGACGATCTCATTAAGTTTCCACAGCTTTTTTGGACGACTTGT
GCTTGTTTAGACTCTATTAACGAGAGAGAATTTCTCGAGGCTGTTGAAATGCTCAACGAGTTGGTGCAGAAATTC
GACCTAAGATCAGGCAATGTGCGGAGGCTGCTGGCAGACGAACAGCCTGAGGGGTGGGACGGCCCGTTTGAAGGC
ATCCAGCCACTGCTCTACAAGGGCTTGAGGTCTGCATTATGTTGGCAGCCAACACTAGATGCGCTAGGACAGCTA
GTCAAGCTTCCTACAGACGCACTGATTGGCGACGATAGCCGTCTCTTCTTTACACTGCTGGCCAACTTTCCTCGC
TTCCTCAACGAGATGGAACGCGGAACAGTGAGCCAAGAGGCCATTGAGACGGCATTGCTATTGCAGGAAGAAACT
GACAAGCAGGGGCTTGAGAGTCTCTGGCTCGTGCTCGACGGCTTGATATCAGGGCAACAGCGAGACGGCGGCGAA
TTCCTGAAACAGCTATTTGCGGCTCTCAAGGAGCACTACCTACCCCGACTAGAATTCAAGATGATTACTTTTCTA
ATAGGGCTGCTCACCAACTCGCTGTCGTGGGTCAAGGTGCAAACTATGCGCATCCTCTGCGTAGCCATTCCAGAG
GTTGACATGCGCAAGCCCGAGCTTGCGGGCCACGGTTCCGACCTCATTTCGCCCTTGCTGCGCCTCTTGCAAACC
GAGTTTTGCATGGATGCACTCGAGGTGCTGGACAACATCATGACTATGTCTGGGAGCCATACGGATCGCCATCAC
GTGAGAATGAGTATGACGCGCTTCACGTCCCGGGCAGTTCGCAAAGAATATGAGCGCACGCAGAGTCTGTTTGGC
ATCCCTGAAGCCTCGGGCTGGGCCATTCCCGTGCCTGCACGAAAGGCTGAGGCGACACGATGCAATGTGCGCGCA
GCATTCCGCATGTGCCAGAGTGCCGAAGGATCGTTTGCCGAGACGACTCCAACCAGTGAGGTTGAGTTCCACGCC
GATGACTACCCATATGGTTACTTTGAGACGGATAGAGCCGACACAATGCTTTCCGACGATGGAAGGATGGATGCC
TTGGGCGGCGACGTGGTGACTAAGCTAGACAGTCTGGATGACTTTTTTGACGAGCAGTCGAGCCCAATGACGGAT
GATGATGACGGGTCGTCGCGCACCATTACCGAGTTTACGCCCGAGGCGTTTGAGTCTAGCACAGAGCTATACGAC
CACCAAATATTGCCCATTTTGAACGAGGCGTCGTCGGGGACTACGCTGTTCCAGAATGGCTTCATGGAGCGGCCC
ATTATGGGAGCGAGGGACGTTGCAGCCAACACTATGAATCCAGGTGCATTCACGGCAGTCATGCCTCCAAGGCCC
GGTTTGCATTCACGCTCTGTCACGTCGCCGTCAGCCCCAGCCTCGTATCAGGCGTTGATAGCAGCTGGAGAGATA
CCATCAGACGACGACTATTTATCGGGGGGGTTGTCCGAAGGCGATGAGGAGCGATCGAGCGCTCGTTATTCCGAA
AAACCATTTATTCTTGAGAGCGTCATTCAATCACCACGACAGGGTGCATCGGGCGGTGCCCGGCGCCTTCTCAGC
AAGTCGCGAGACGAGGCTGTTGCACCCGTCACGCCCCGCATGCCAACCAAGATGTTTTGA
Transcript >OphauB2|1195
ATGGCGCCGTCTCAGCCACCGCCGGACAAGGTGCAGGATTCGCTCAAGTTGGTCGCTCGATCCGTCTCGCGACTC
GACGACGACGCCGAGGACCGGACAGTGCGGCCTCGACCCTTCAGCCCCAAGCCATCGCGCTTTGCCTCCCATTCG
AGAGAGCCGTCGCTCGAGAAGCAACTCCCGGCGACTTTGACGTCTCCGCGCGTCCGTCAAATCACGGGCGGTGCA
TCCTCAGCCCCAGCATCCTCAAGCCCAACATCATCACCAGCATCCGCCCCAACCAGCGCATCATCAAGTGGCATT
ATTGAGCGTCCCATCGACCCGACAAAAGCAGCCCTATACGGCCATCATCGCCAGACATCTATTGTACACGGCTAC
CAACATTCGAGAAATGGCAGCGTTGCAAGCTCCGCCGGCCCTGTTAGCCCTCAGATGATTGCCGCCGCCGCCGGC
GCTGACGTGCAATCAGTAGCTGCCCGTTTAGAGTCCGACGGTTCGACGCAACCCCGGGCTCCGACGTCCTTGGCT
GAGTCTCTGGCAAGCGCCAGCAGTCTTTCAATGGAGAGATCGGCTTCTGCTACCGATGCCTCTCCTGGCCCGGCT
GCTGGCTTGCGCAAGCTCGAGCGAGGACACAGTAAATCGCACTCGTCGCGGCACCATCGCGAAGACCAAAAGACT
GTTGGCGAATGTGCCTTTCATGTCCTTTTGACCTCGTTTGTGGGACAAGCCGAAGAAAAGTTGGCCGAGTCTCTG
GTTGAGCCTCTAGATGTCGAGCCCCAGATTGAGCGAATATGTGGCCCTGGTGTTGACCAAGCCTTTGATCAGCTG
ATCATTGCCCTTGGACATATAGCCAGGCCCAAACCCAAGCCTCTGATTGACACGGTAATGTTGTGGAGGAAGCAC
AAGAGCGAAGCCGTCACCGAAGCCCGTACCCAGCTCCAACAACTGCGCGGAAACCAATCTATTGGCAGTCTGGTA
CGCAGGAACACAGAGCCAGTCCAGAGTGGCCCTGAAAATGCCTCCCCTACTGGAGCCACCGTCTCAACCTTGCAG
AAGCTTGTTTCACAGCAGGAGCGACGATCTACGGTTGCCACATACATCTTGTGCCGGGTGCTACTCGAAGTTTTT
TCCAAGACGACAATGTCATGTATAGGCAGCGATATGGAAGACAAGTTGGAGGGCATCATGTTTACCCAGCTCAAG
ATTACTGAGTGGGAGCAACTGGTCAGCTCACCTCTCAAACTGGCCAACTGGAGCCTTTTTGCGCAGTTGCTGGGC
CACATGAGCGCCATCAACTTCAATGTGGTCACTGGGCGCTTTCTTGAGGAGCTGGAAAAGTCGGTACAGGACCGC
GCACTTGTCCGGAGCCCTACGTCGTCGGCCAGCGGGCGCGATCCCGAGACCAAGCAATATCTTGTCCTTGGTGGC
ATGCAACACTTGCGTATAAAGCTTCAGCCAGATGCCGCCTGGGAGGACTCTTGTGAATTTCTCATTGCTCTGGGC
CGCCTGTTTAACCGATGTCGCGGCCTCCGCATTAAGATGGCCTTTTGCCAGATCCTTCAGCTGCTAGTACTTCCA
ATCGCTGCCCAAGCCAGTAGCAATCATCTAACACATCCCAAATGGGCCGAGGTCATGTCCACCATTAGTCAACGC
CTCGGTCAGATTTTTATGAAGCCACGATATTGGACCGTCGCTTTTCCACTGACTGCGACCATGCTCTGTCTTTCA
TCGCCCGATACATTTGCATCCCAATGGTCTCAACTGACCCTGTCGTTGCAAACAAAGTTCAGGGATCGGCCGACA
CGACCACTTTGTCTGCAAGTCATATCTCGCTTGCTGTGGACCTATCTTTTTCGCGCCACCGACAGTCTTCAGAGC
TCCGCCAAGAAGCTTGACGACTTGGTAAAGCTTGTTATGCCGCCTCCTGCCAAACGCAACGCCATATCATTTGAT
CCAGCAGTCACAGAGCCCATGATACAGATTATTCGAATAATAGGCTTCAGATACCCCGAGTATTGCTTCCGATCT
GTTATTTTCCCACTCATCAACGCCGACCTGTTTGTTGCCAACAAGGAGCTCAAGGTTGAACAGCTTGAACCTGAC
CGCATCGTCGTTGGCATTAGGGCCTTTCTCTGCATCATGTCCGACTTGGAAAAGGGCGACAAGGGCCAGCCTCCG
TTCCCACAATTCTACCACGGAGACCCTTTGACGGATAAACTTCCCCTCTATCCAATACTGTCTCTGGCACGCAAC
AGCCAGACGTCAAATTCTGATGCCTCGCTTACAGAGGCGCGTCCGGTGCTCACACAGCAACTGAGCGAAGGCGTG
CGCGAGTATTACTCACAGTTTTGCCAAATACTCGGAAAGATTACAATTATTTGCGATAACACTTTTGGGGGGCAG
GCGGCATTGGACGAGCGATTTAATAGCCCTGGACCCAAGACGCCAATCGCTGACACTTTTAATTTTGCGCGTCGT
GATGAGCACCAGATTGCCGCCGACCAGAAGCAGGCTTTTTACGAACTCCTGCACGTGGCTGTCAAGGCTCTTCCT
CGTTGTCTGTCGGTCGACATTCCAATCAACCCTCTTATCAATTTGTTGTGTACTGGCACAGCCCATGTTCAAAAT
AATATTGCACAGTCATCGGCAACTTCACTCAAGGCCATTGCTAGGCACTCGCATGCTCAACAAGTGACAATGGGC
TTTGCTCGCTTCATTTTCAACTTTGATGATCGATACTCAACCATGTCTGATGGTGGCATGCTTGGGCCCGATCAC
ATTGAGAATACGCTTCGACTGTACGTTGAATTATTACAGATTTGGATCGACGAGATCAAACAAAAGTCGCGCGAC
GCAGCGTCGAGTCCAGCCGAAGCAAGTGCATCAGATAAGCGAGCCCTCAAGCTGGATTTGTCGAGCATCTGGGCC
GAGGTGGACCAAGCAGAAGCTCATGGCCTTTTTTTCCTTTGTTCCCAGTCACGGCGCGTCCGTCATTACGCCGTT
ACGGCCCTGCGACTCATCACAGAGTTTGACAAGGCTCTCGGCAAGGGAACAACAGAAGAAAAGGAATCACCAAGG
CTCATAAACATACTCGAGAACTACTCGAGCCAAGTAATGGACTTTAATGATGAGCATTTGACTGTTGCTGAACGC
AGCAGACTTCAAAGGGCCTTTGACAAGTGCCCCTTTACCGTCGCCATCTGCCGTGACCTTGTGGGCAATCGCATT
CTCGAAATGTACACAGCCATTGTGCACCTCTCTGAGCCCAATCGTGGCTTTTATTACTTGGCTGATCAGTCCAAT
GGGCGAGCACCTGTGCGATCGCCAGCGGCCCAACCTGAAGTCTTGATTGAGCAGTGGAAGCTTTACCTCATCTTT
GCCTGCACGACTCTTGCCGATGCTGGCACCCAGACGCCCAATCCTGCAAAGGAAACTCAGCATGCAAGAAAGACT
TCCAAGCAACCGATGGATAAGATTGTGACGGCACGCACCTTGTTCAAGTATCTGCTTCCACTGCTTTCCTGCTCA
TCGGCTTCGGTCCGGGATGCCGTCGTGGTGGCCATGGGATCTATCAATAAGCACATTTATCGACCCCTGGTCGAG
GAGCTGTACGGCCATGTATGCAGGGTCCATGATGATTCGCGAGCCCGCATTCACAGTCGAAGTAATAGCATTCCG
AGACGCAATCGGACAATTGCCCTCATGCGTACGGAGGCAACGCATGTCTTTAAGTTGACAGCGCATTTCCTCAAG
GAACCCCCACTCCCACATGTCGAATACATTCTAGACACACTGTCCGCATACACAAAGGATTTGAAGCTCCTCCTC
ATGGATGGGGAGGTGCAGATGGATTGGGAGTTTCAGCAGCTCAGGCGACACTACTGTGGTCTCATAGAGATCATG
TTTGAGGGGGTGAGCATGACGGACAATCCACTTAGATGGATGACATTTGAAGCTAGAAAATCAGCCTTTTCGCTC
ATGGAAGACTGGTGCGGCTTCTCGCCCAATCAGACGCAGATAAAGGTCAGAGAGCACACGATGAGGCAATCGCTC
TTGGATCGCCAGGCAAGTGTTGAGCCCAAGATTGTTTCGGCTGCCATGGAAAGAGAGCGGCACAATCTCAAAACT
GCGGCGCTCAACTCTATGGCGACGCTTTGTGCCGGACCGCTCATGGTTGTGACTGAAAGCGGCATCACGTTGCAG
TTTGACATGCGTCGCATGCTTGTCTGGATTGAGGCTATTTTCAACTCTGGAAACGACAAGATGAAAATGACGGGT
CGCAGAGCCTTGAAGAACTTGTTGGTGCATAACCGAGAAATTCCATATCTCGTTGAGAACTGTATTTCTCGTTGC
TACCTGTCACAGGTTCCCAAGGTACTCGAGAGCTACTTTACAGTGACTATCGAGGTGCTACAAGAGCATGGTGAC
TATCCCTGTCCCTTTTGGAGAACTCTGGGCCTCTGTCTCTTCATCCTAGGCAACGATCAAAGTACCATACGGACC
AAGTCGTCAACCATGCTTCGGACTTTGGACACCCGTCAACAGCGCAATTCCAAGATTCAAGACTTTGACATTAGC
ATTTCGGACAAGACACAAGCCGTATATAAACTCGCACAATTTGAAATTTCCAAGCGCCTGGCCAAGCAACACGCC
GATCTTGCTTTTTACATCTTCTCCGACTTTGCATACTACTTTAAAGATCTTGTACCGGCAGCACAGCGGAACGTC
ATTGCCGTTATTCTCCCTTGGATCCAGGCTGTGGAGCTCAAATTGGACCCCAATGGCGGTCCTACGGCCGAGTCG
TACGTTCTTTTGGCCAACCTTTTGGACTTGACCATCAAATCGGGCGGCGCCCTGCACAATGAGGTCCAGGCCTTG
TGGCAGGCATTGGCCACTGGACCTTACCCAGGAAACGTGCGTCTAGTTTTGGATTTTATCATGCAGCTCTGTCTA
GAGAGACGCGAACAAAACTTTGTCGAGTACGCCAAGCAAATAGTTGTCTTTCTCTCCACCACAAACAGCACTCCA
GGCATCAAGGTTGTCGAGTTCCTGCTCATGCAAATCACTCCAAAAGCCATGGTGCCCCATGAGATAAGAGAAGCA
GTGCCACCACCGCCCGAGATAAATAGCCTGCCATATTGTGCTGACCTCAGCAGTATGCTGCCTGTCGGGCCCAAA
CCAGCTGGATTTTCTCTCGGACAGTTGTCGCTCATTCTGCTTGTTGACTTGATGGTGTCCCCGGTGCAACTCAAG
GCCGAGAGCGTACCTCTTATCCTCCAGGTTGTGACTGTTTTATGGGACCACTACACGCCTTTGGTGCAGGATCAA
GCACAAGAGATGCTTGTACACCTTGTACATGAACTCGTCATCTCTCGCTTGGATGATGAACAGCAGGGCAACGTG
AAACAATCTTTTCAAGAATTGGTCGATCTTACCCGGCGGCATGATCGCTCTGTCGTCTGGGACTATGAAGACAGC
AATGGAAACCTTGATGACCAAGCTAATAAGGTGCCGCCTGGCATGGAGGTTTTGACGACGCGAATTGTCGAGACG
TTTGAAACGACCTTTGCAGGAATTAAAGAACAATGGGGCCGCTTGTCCTTGACGTGGGCTACCTCGTGCCCAGTT
CGACACTTGGCCCGGCGGTCGTTTCAGATATTTCGCTGTGTGCTCACTTCATTGGATCAACGCATGCTCGGAGAC
ATGCTGGCCAGACTGTCAAATGCCGTTGCTGACGAGGATGCCGAGATTCGGTCGTTTTCAATGGAGATTTTGACG
ACGCTCAAGACTCTGATTGTGAAGCTTGACGCCGACGATCTCATTAAGTTTCCACAGCTTTTTTGGACGACTTGT
GCTTGTTTAGACTCTATTAACGAGAGAGAATTTCTCGAGGCTGTTGAAATGCTCAACGAGTTGGTGCAGAAATTC
GACCTAAGATCAGGCAATGTGCGGAGGCTGCTGGCAGACGAACAGCCTGAGGGGTGGGACGGCCCGTTTGAAGGC
ATCCAGCCACTGCTCTACAAGGGCTTGAGGTCTGCATTATGTTGGCAGCCAACACTAGATGCGCTAGGACAGCTA
GTCAAGCTTCCTACAGACGCACTGATTGGCGACGATAGCCGTCTCTTCTTTACACTGCTGGCCAACTTTCCTCGC
TTCCTCAACGAGATGGAACGCGGAACAGTGAGCCAAGAGGCCATTGAGACGGCATTGCTATTGCAGGAAGAAACT
GACAAGCAGGGGCTTGAGAGTCTCTGGCTCGTGCTCGACGGCTTGATATCAGGGCAACAGCGAGACGGCGGCGAA
TTCCTGAAACAGCTATTTGCGGCTCTCAAGGAGCACTACCTACCCCGACTAGAATTCAAGATGATTACTTTTCTA
ATAGGGCTGCTCACCAACTCGCTGTCGTGGGTCAAGGTGCAAACTATGCGCATCCTCTGCGTAGCCATTCCAGAG
GTTGACATGCGCAAGCCCGAGCTTGCGGGCCACGGTTCCGACCTCATTTCGCCCTTGCTGCGCCTCTTGCAAACC
GAGTTTTGCATGGATGCACTCGAGGTGCTGGACAACATCATGACTATGTCTGGGAGCCATACGGATCGCCATCAC
GTGAGAATGAGTATGACGCGCTTCACGTCCCGGGCAGTTCGCAAAGAATATGAGCGCACGCAGAGTCTGTTTGGC
ATCCCTGAAGCCTCGGGCTGGGCCATTCCCGTGCCTGCACGAAAGGCTGAGGCGACACGATGCAATGTGCGCGCA
GCATTCCGCATGTGCCAGAGTGCCGAAGGATCGTTTGCCGAGACGACTCCAACCAGTGAGGTTGAGTTCCACGCC
GATGACTACCCATATGGTTACTTTGAGACGGATAGAGCCGACACAATGCTTTCCGACGATGGAAGGATGGATGCC
TTGGGCGGCGACGTGGTGACTAAGCTAGACAGTCTGGATGACTTTTTTGACGAGCAGTCGAGCCCAATGACGGAT
GATGATGACGGGTCGTCGCGCACCATTACCGAGTTTACGCCCGAGGCGTTTGAGTCTAGCACAGAGCTATACGAC
CACCAAATATTGCCCATTTTGAACGAGGCGTCGTCGGGGACTACGCTGTTCCAGAATGGCTTCATGGAGCGGCCC
ATTATGGGAGCGAGGGACGTTGCAGCCAACACTATGAATCCAGGTGCATTCACGGCAGTCATGCCTCCAAGGCCC
GGTTTGCATTCACGCTCTGTCACGTCGCCGTCAGCCCCAGCCTCGTATCAGGCGTTGATAGCAGCTGGAGAGATA
CCATCAGACGACGACTATTTATCGGGGGGGTTGTCCGAAGGCGATGAGGAGCGATCGAGCGCTCGTTATTCCGAA
AAACCATTTATTCTTGAGAGCGTCATTCAATCACCACGACAGGGTGCATCGGGCGGTGCCCGGCGCCTTCTCAGC
AAGTCGCGAGACGAGGCTGTTGCACCCGTCACGCCCCGCATGCCAACCAAGATGTTTTGA
Gene >OphauB2|1195
ATGGGTAAGCATTCTTGTCGACTGCTTTGTTTGTGTCGGTGTCGGGCGCTAGACTGCCCCGTTGTTTGATGTTGA
GACTGCCCAACTCGGCCCTACCGTATTCGTAACACGAGGCCCAAACGACTGGACTCTGCTCAATTGACGTCTCGT
GTCTCATGTTGCAGGAGACGACGGGGAGGACTAACGAAAAAGGAGACACCCCTCCAAGTGGGAACCTGCTGACCA
TTTATCACTCGCTCAGCGCCGTCTCAGCCACCGCCGGACAAGGTGCAGGATTCGCTCAAGTTGGTCGCTCGATCC
GTCTCGCGACTCGACGACGACGCCGAGGACCGGACAGTGCGGCCTCGACCCTTCAGCCCCAAGCCATCGCGCTTT
GCCTCCCATTCGAGAGAGCCGTCGCTCGAGAAGCAACTCCCGGCGACTTTGACGTCTCCGCGCGTCCGTCAAATC
ACGGGCGGTGCATCCTCAGCCCCAGCATCCTCAAGCCCAACATCATCACCAGCATCCGCCCCAACCAGCGCATCA
TCAAGTGGCATTATTGAGCGTCCCATCGACCCGACAAAAGCAGCCCTATACGGCCATCATCGCCAGACATCTATT
GTACACGGCTACCAACATTCGAGAAATGGCAGCGTTGCAAGCTCCGCCGGCCCTGTTAGCCCTCAGATGATTGCC
GCCGCCGCCGGCGCTGACGTGCAATCAGTAGCTGCCCGTTTAGAGTCCGACGGTTCGACGCAACCCCGGGCTCCG
ACGTCCTTGGCTGAGTCTCTGGCAAGCGCCAGCAGTCTTTCAATGGAGAGATCGGCTTCTGCTACCGATGCCTCT
CCTGGCCCGGCTGCTGGCTTGCGCAAGCTCGAGCGAGGACACAGTAAATCGCACTCGTCGCGGCACCATCGCGAA
GACCAAAAGACTGTTGGCGAATGTGCCTTTCATGTCCTTTTGACCTCGGTAAGTCTTTGCAATCGAGACTGTCGA
CCACCGGGGCCATTTCTGACTTGACATTCTAGTTTGTGGGACAAGCCGAAGAAAAGTTGGCCGAGTCTCTGGTTG
AGCCTCTAGATGTCGAGCCCCAGATTGAGCGAATATGTGGCCCTGGTGTTGACCAAGCCTTTGATCAGCTGATCA
TTGCCCTTGGACATATAGCCAGGCCCAAACCCAAGCCTCTGATTGACACGGTAATGTTGTGGAGGAAGCACAAGA
GCGAAGCCGTCACCGAAGCCCGTACCCAGCTCCAACAACTGCGCGGAAACCAATCTATTGGCAGTCTGGTACGCA
GGAACACAGAGCCAGTCCAGAGTGGCCCTGAAAATGCCTCCCCTACTGGAGCCACCGTCTCAACCTTGCAGAAGC
TTGTTTCACAGCAGGAGCGACGATCTACGGTTGCCACATACATCTTGTGCCGGGTGCTACTCGAAGTTTTTTCCA
AGACGACAATGTCATGTATAGGCAGCGATATGGAAGACAAGTTGGAGGGCATCATGTTTACCCAGCTCAAGATTA
CTGAGTGGGAGCAACTGGTCAGCTCACCTCTCAAACTGGCCAACTGGAGCCTTTTTGCGCAGTTGCTGGGCCACA
TGAGCGCCATCAACTTCAATGTGGTCACTGGGCGCTTTCTTGAGGAGCTGGAAAAGTCGGTACAGGACCGCGCAC
TTGTCCGGAGCCCTACGTCGTCGGCCAGCGGGCGCGATCCCGAGACCAAGCAATATCTTGTCCTTGGTGGCATGC
AACACTTGCGTATAAAGCTTCAGCCAGATGCCGCCTGGGAGGACTCTTGTGAATTTCTCATTGCTCTGGGCCGCC
TGTTTAACCGATGTCGCGGCCTCCGCATTAAGATGGCCTTTTGCCAGATCCTTCAGCTGCTAGTACTTCCAATCG
CTGCCCAAGCCAGTAGCAATCATCTAACACATCCCAAATGGGCCGAGGTCATGTCCACCATTAGTCAACGCCTCG
GTCAGATTTTTATGAAGCCACGATATTGGACCGTCGCTTTTCCACTGACTGCGACCATGCTCTGTCTTTCATCGC
CCGATACATTTGCATCCCAATGGTCTCAACTGACCCTGTCGTTGCAAACAAAGTTCAGGGATCGGCCGACACGAC
CACTTTGTCTGCAAGTCATATCTCGCTTGCTGTGGACCTATCTTTTTCGCGCCACCGACAGTCTTCAGAGCTCCG
CCAAGAAGCTTGACGACTTGGTAAAGCTTGTTATGCCGCCTCCTGCCAAACGCAACGCCATATCATTTGATCCAG
CAGTCACAGAGCCCATGATACAGATTATTCGAATAATAGGCTTCAGATACCCCGAGTATTGCTTCCGATCTGTTA
TTTTCCCACTCATCAACGCCGACCTGTTTGTTGCCAACAAGGAGCTCAAGGTTGAACAGCTTGAACCTGACCGCA
TCGTCGTTGGCATTAGGGCCTTTCTCTGCATCATGTCCGACTTGGAAAAGGGCGACAAGGGCCAGCCTCCGTTCC
CACAATTCTACCACGGAGACCCTTTGACGGATAAACTTCCCCTCTATCCAATACTGTCTCTGGCACGCAACAGCC
AGACGTCAAATTCTGATGCCTCGCTTACAGAGGCGCGTCCGGTGCTCACACAGCAACTGAGCGAAGGCGTGCGCG
AGTATTACTCACAGTTTTGCCAAATACTCGGAAAGATTACAATTATTTGCGATAACACTTTTGGGGGGCAGGCGG
CATTGGACGAGCGATTTAATAGCCCTGGACCCAAGACGCCAATCGCTGACACTTTTAATTTTGCGCGTCGTGATG
AGCACCAGATTGCCGCCGACCAGAAGCAGGCTTTTTACGAACTCCTGCACGTGGCTGTCAAGGCTCTTCCTCGTT
GTCTGTCGGTCGACATTCCAATCAACCCTCTTATCAATTTGTTGTGTACTGGCACAGCCCATGTTCAAAATAATA
TTGCACAGTCATCGGCAACTTCACTCAAGGCCATTGCTAGGCACTCGCATGCTCAACAAGTGACAATGGGCTTTG
CTCGCTTCATTTTCAACTTTGATGATCGATACTCAACCATGTCTGATGGTGGCATGCTTGGGCCCGATCACATTG
AGAATACGCTTCGACTGTACGTTGAATTATTACAGATTTGGATCGACGAGATCAAACAAAAGTCGCGCGACGCAG
CGTCGAGTCCAGCCGAAGCAAGTGCATCAGATAAGCGAGCCCTCAAGCTGGATTTGTCGAGCATCTGGGCCGAGG
TGGACCAAGCAGAAGCTCATGGCCTTTTTTTCCTTTGTTCCCAGTCACGGCGCGTCCGTCATTACGCCGTTACGG
CCCTGCGACTCATCACAGAGTTTGACAAGGCTCTCGGCAAGGGAACAACAGAAGAAAAGGAATCACCAAGGCTCA
TAAACATACTCGAGAACTACTCGAGCCAAGTAATGGACTTTAATGATGAGCATTTGACTGTTGCTGAACGCAGCA
GACTTCAAAGGGGTATGCAGAATGCCAACAGAAAGGGCGTCGTGGTCGAACTATGCACTAGCGACATCACATATG
ACACAACTCTGTGGTTCAACATATTTCCTAACCTGATACGCATAGCCTTTGACAAGTGCCCCTTTACCGTCGCCA
TCTGCCGTGACCTTGTGGGCAATCGCATTCTCGAAATGTACACAGCCATTGTGCACCTCTCTGAGCCCAATCGTG
GCTTTTATTACTTGGCTGATCAGTCCAATGGGCGAGCACCTGTGCGATCGCCAGCGGCCCAACCTGAAGTCTTGA
TTGAGCAGTGGAAGCTTTACCTCATCTTTGCCTGCACGACTCTTGCCGATGCTGGCACCCAGACGCCCAATCCTG
CAAAGGAAACTCAGCATGCAAGAAAGACTTCCAAGCAACCGATGGATAAGATTGTGACGGCACGCACCTTGTTCA
AGTATCTGCTTCCACTGCTTTCCTGCTCATCGGCTTCGGTCCGGGATGCCGTCGTGGTGGCCATGGGATCTATCA
ATAAGCACATTTATCGACCCCTGGTCGAGGAGCTGTACGGCCATGTATGCAGGGTCCATGATGATTCGCGAGCCC
GCATTCACAGTCGAAGTAATAGCATTCCGAGACGCAATCGGACAATTGCCCTCATGCGTACGGAGGCAACGCATG
TCTTTAAGTTGACAGCGCATTTCCTCAAGGAACCCCCACTCCCACATGTCGAATACATTCTAGACACACTGTCCG
CATACACAAAGGATTTGAAGCTCCTCCTCATGGATGGGGAGGTGCAGATGGATTGGGAGTTTCAGCAGCTCAGGC
GACACTACTGTGGTCTCATAGAGATCATGTTTGAGGGGGTGAGCATGACGGACAATCCACTTAGATGGATGACAT
TTGAAGCTAGAAAATCAGCCTTTTCGCTCATGGAAGACTGGTGCGGCTTCTCGCCCAATCAGACGCAGATAAAGG
TCAGAGAGCACACGATGAGGCAATCGCTCTTGGATCGCCAGGCAAGTGTTGAGCCCAAGATTGTTTCGGCTGCCA
TGGAAAGAGAGCGGCACAATCTCAAAACTGCGGCGCTCAACTCTATGGCGACGCTTTGTGCCGGACCGCTCATGG
TTGTGACTGAAAGCGGCATCACGTTGCAGTTTGACATGCGTCGCATGCTTGTCTGGATTGAGGCTATTTTCAACT
CTGGAAACGACAAGATGAAAATGACGGGTCGCAGAGCCTTGAAGAACTTGTTGGTGCATAACCGAGAAATTCCAT
ATCTCGTTGAGAACTGTATTTCTCGTTGCTACCTGTCACAGGTTCCCAAGGTACTCGAGAGCTACTTTACAGTGA
CTATCGAGGTGCTACAAGAGCATGGTGACTATCCCTGTCCCTTTTGGAGAACTCTGGGCCTCTGTCTCTTCATCC
TAGGCAACGATCAAAGTACCATACGGACCAAGTCGTCAACCATGCTTCGGACTTTGGACACCCGTCAACAGCGCA
ATTCCAAGATTCAAGACTTTGACATTAGCATTTCGGACAAGACACAAGCCGTATATAAACTCGCACAATTTGAAA
TTTCCAAGCGCCTGGCCAAGCAACACGCCGATCTTGCTTTTTACATCTTCTCCGACTTTGCATACTACTTTAAAG
ATCTTGTACCGGCAGCACAGCGGAACGTCATTGCCGTTATTCTCCCTTGGATCCAGGCTGTGGAGCTCAAATTGG
ACCCCAATGGCGGTCCTACGGCCGAGTCGTACGTTCTTTTGGCCAACCTTTTGGACTTGACCATCAAATCGGGCG
GCGCCCTGCACAATGAGGTCCAGGCCTTGTGGCAGGCATTGGCCACTGGACCTTACCCAGGAAACGTGCGTCTAG
TTTTGGATTTTATCATGCAGCTCTGTCTAGAGAGACGCGAACAAAACTTTGTCGAGTACGCCAAGCAAATAGTTG
TCTTTCTCTCCACCACAAACAGCACTCCAGGCATCAAGGTTGTCGAGTTCCTGCTCATGCAAATCACTCCAAAAG
CCATGGTGCCCCATGAGATAAGAGAAGCAGTGCCACCACCGCCCGAGATAAATAGCCTGCCATATTGTGCTGACC
TCAGCAGTATGCTGCCTGTCGGGCCCAAACCAGCTGGATTTTCTCTCGGACAGTTGTCGCTCATTCTGCTTGTTG
ACTTGATGGTGTCCCCGGTGCAACTCAAGGCCGAGAGCGTACCTCTTATCCTCCAGGTTGTGACTGTTTTATGGG
ACCACTACACGCCTTTGGTGCAGGATCAAGCACAAGAGATGCTTGTACACCTTGTACATGAACTCGTCATCTCTC
GCTTGGATGATGAACAGCAGGGCAACGTGAAACAATCTTTTCAAGAATTGGTCGATCTTACCCGGCGGCATGATC
GCTCTGTCGTCTGGGACTATGAAGACAGCAATGGAAACCTTGATGACCAAGCTAATAAGGTGCCGCCTGGCATGG
AGGTTTTGACGACGCGAATTGTCGAGACGTTTGAAACGACCTTTGCAGGAATTAAAGAACAATGGGGCCGCTTGT
CCTTGACGTGGGCTACCTCGTGCCCAGTTCGACACTTGGCCCGGCGGTCGTTTCAGATATTTCGCTGTGTGCTCA
CTTCATTGGATCAACGCATGCTCGGAGACATGCTGGCCAGACTGTCAAATGCCGTTGCTGACGAGGATGCCGAGA
TTCGGTCGTTTTCAATGGAGATTTTGACGACGCTCAAGACTCTGATTGTGAAGCTTGACGCCGACGATCTCATTA
AGTTTCCACAGCTTTTTTGGACGACTTGTGCTTGTTTAGACTCTATTAACGAGAGAGAATTTCTCGAGGCTGTTG
AAATGCTCAACGAGTTGGTGCAGAAATTCGACCTAAGATCAGGCAATGTGCGGAGGCTGCTGGCAGACGAACAGC
CTGAGGGGTGGGACGGCCCGTTTGAAGGCATCCAGCCACTGCTCTACAAGGGCTTGAGGTCTGCATTATGTTGGC
AGCCAACACTAGATGCGCTAGGACAGCTAGTCAAGCTTCCTACAGACGCACTGATTGGCGACGATAGCCGTCTCT
TCTTTACACTGCTGGCCAACTTTCCTCGCTTCCTCAACGAGATGGAACGCGGAACAGTGAGCCAAGAGGCCATTG
AGACGGCATTGCTATTGCAGGAAGAAACTGACAAGCAGGGGCTTGAGAGTCTCTGGCTCGTGCTCGACGGCTTGA
TATCAGGGCAACAGCGAGACGGCGGCGAATTCCTGAAACAGCTATTTGCGGCTCTCAAGGAGCACTACCTACCCC
GACTAGAATTCAAGATGATTACTTTTCTAATAGGGCTGCTCACCAACTCGCTGTCGTGGGTCAAGGTGCAAACTA
TGCGCATCCTCTGCGTAGCCATTCCAGAGGTTGACATGCGCAAGCCCGAGCTTGCGGGCCACGGTTCCGACCTCA
TTTCGCCCTTGCTGCGCCTCTTGCAAACCGAGTTTTGCATGGATGCACTCGAGGTGCTGGACAACATCATGACTA
TGTCTGGGAGCCATACGGATCGCCATCACGTGAGAATGAGTATGACGCGCTTCACGTCCCGGGCAGTTCGCAAAG
AATATGAGCGCACGCAGAGTCTGTTTGGCATCCCTGAAGCCTCGGGCTGGGCCATTCCCGTGCCTGCACGAAAGG
CTGAGGCGACACGATGCAATGTGCGCGCAGCATTCCGCATGTGCCAGAGTGCCGAAGGATCGTTTGCCGAGACGA
CTCCAACCAGTGAGGTTGAGTTCCACGCCGATGACTACCCATATGGTTACTTTGAGACGGATAGAGCCGACACAA
TGCTTTCCGACGATGGAAGGATGGATGCCTTGGGCGGCGACGTGGTGACTAAGCTAGACAGTCTGGATGACTTTT
TTGACGAGCAGTCGAGCCCAATGACGGATGATGATGACGGGTCGTCGCGCACCATTACCGAGTTTACGCCCGAGG
CGTTTGAGTCTAGCACAGAGCTATACGACCACCAAATATTGCCCATTTTGAACGAGGCGTCGTCGGGGACTACGC
TGTTCCAGAATGGCTTCATGGAGCGGCCCATTATGGGAGCGAGGGACGTTGCAGCCAACACTATGAATCCAGGTG
CATTCACGGCAGTCATGCCTCCAAGGCCCGGTTTGCATTCACGCTCTGTCACGTCGCCGTCAGCCCCAGCCTCGT
ATCAGGCGTTGATAGCAGCTGGAGAGATACCATCAGACGACGACTATTTATCGGGGGGGTTGTCCGAAGGCGATG
AGGAGCGATCGAGCGCTCGTTATTCCGAAAAACCATTTATTCTTGAGAGCGTCATTCAATCACCACGACAGGGTG
CATCGGGCGGTGCCCGGCGCCTTCTCAGCAAGTCGCGAGACGAGGCTGTTGCACCCGTCACGCCCCGCATGCCAA
CCAAGATGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail