Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1189
Gene name
LocationContig_13:19481..21768
Strand+
Gene length (bp)2287
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 7.5E-30 76 215
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 3.0E-12 425 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56216|VAOX_PENSI Vanillyl-alcohol oxidase OS=Penicillium simplicissimum GN=VAOA PE=1 SV=1 30 564 3.0E-92
sp|P09788|DH4C_PSEPU 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida GN=pchF PE=1 SV=3 30 556 4.0E-72
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 40 283 3.0E-18
sp|P9WIT1|Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2280 PE=1 SV=1 39 290 2.0E-16
sp|P9WIT0|Y2280_MYCTO Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2338 PE=3 SV=1 39 290 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56216|VAOX_PENSI Vanillyl-alcohol oxidase OS=Penicillium simplicissimum GN=VAOA PE=1 SV=1 30 564 3.0E-92
sp|P09788|DH4C_PSEPU 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida GN=pchF PE=1 SV=3 30 556 4.0E-72
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 40 283 3.0E-18
sp|P9WIT1|Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2280 PE=1 SV=1 39 290 2.0E-16
sp|P9WIT0|Y2280_MYCTO Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2338 PE=3 SV=1 39 290 2.0E-16
sp|Q86WU2|LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens GN=LDHD PE=1 SV=1 37 263 5.0E-15
sp|Q7TNG8|LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus GN=Ldhd PE=1 SV=1 40 263 4.0E-13
sp|P32891|DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD1 PE=1 SV=2 76 268 2.0E-08
sp|P0AEQ0|GLCD_ECOL6 Glycolate oxidase subunit GlcD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glcD PE=3 SV=1 76 283 3.0E-08
sp|P0AEP9|GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) GN=glcD PE=3 SV=1 76 283 3.0E-08
sp|Q9EQR2|ADAS_RAT Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Rattus norvegicus GN=Agps PE=2 SV=1 11 260 1.0E-07
sp|O29853|DLD_ARCFU D-lactate dehydrogenase (acceptor) OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dld PE=1 SV=1 78 283 3.0E-07
sp|Q8C0I1|ADAS_MOUSE Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Mus musculus GN=Agps PE=1 SV=1 68 260 5.0E-07
sp|Q8N465|D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=D2HGDH PE=1 SV=3 82 277 6.0E-07
sp|P46681|DLD2_YEAST D-lactate dehydrogenase [cytochrome] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD2 PE=1 SV=1 82 278 1.0E-06
sp|Q1JPD3|D2HDH_BOVIN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=D2HGDH PE=2 SV=2 82 277 1.0E-06
sp|P84850|D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=D2hgdh PE=3 SV=1 26 262 4.0E-06
sp|Q8CIM3|D2HDH_MOUSE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=D2hgdh PE=1 SV=3 26 260 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1189
MSSHHYQARDVQEAHDRVFKPGRTPPKQQLPPGKTAEQLKEILQALAAIVGDDNVGTGEALLHFSDPFTLEESSF
PSAAVCPATVEEIKAILEYANKADFPLWTTSRGKNLGYGGPSPRVKGSVVLSLYRMNRILEVNEKAAYAVVEPGV
TFFDLYNHCREHKLSLWPSVPAIAWGSVIGNTLDRGFGYTALGDHQNNICGIEAVLPDGDIVRTGQWAVESSPST
FACKAGFGPQLEGLFLQSNLGVVTKMGLWIQPQPETTMTVCLELERLEELEQLVDMIAELRREGILQNDPSIFDV
FRRISRLGPRHEVYSGSGAIPEERVEKLMREQGWGYWKTWFSLYGKKDMVLSRLGWTQQTVAKKCPTARLTYKLF
EGGGAGEQGVDQGGERRVDATSVDAEWQPMNAGVPSLRYAATIDYNTPPGGYGGHMDFSPILPLDGAMALDWYGQ
VRSISRQHGFDSFLGGHAFSKHLVLVHMIMFDRLNAGQVAKAKELWRALATRARQLGFATYRTHLDWMDYVQDCY
DFNHNAQRRFVEHLKDSTDPKGILSPGKSGIWPKKYRHLRAG*
Coding >OphauB2|1189
ATGTCGTCGCACCACTATCAGGCCAGGGACGTGCAAGAGGCGCATGACCGCGTCTTCAAGCCTGGCCGCACGCCT
CCCAAGCAGCAGCTGCCGCCAGGAAAGACGGCCGAGCAGCTCAAGGAGATTTTGCAGGCGCTGGCAGCCATTGTA
GGCGACGACAATGTTGGCACTGGAGAGGCACTGCTGCACTTTTCCGATCCCTTTACGCTTGAGGAATCGAGTTTT
CCTAGTGCGGCCGTATGCCCAGCTACAGTAGAAGAGATCAAGGCCATTCTAGAATACGCCAACAAGGCCGACTTT
CCCCTGTGGACAACGTCCAGAGGCAAGAATCTCGGATATGGCGGCCCGTCGCCGCGCGTCAAGGGCTCCGTGGTG
CTTTCGCTCTACCGTATGAATCGCATCCTCGAGGTGAATGAAAAAGCGGCGTATGCTGTTGTGGAGCCGGGCGTC
ACGTTTTTCGATCTCTACAACCACTGCCGAGAGCACAAGCTCTCTCTGTGGCCAAGCGTGCCTGCAATTGCTTGG
GGGAGTGTCATTGGCAATACTCTAGATCGCGGCTTTGGCTACACGGCCCTTGGAGACCACCAAAACAACATTTGC
GGCATCGAGGCCGTCTTGCCTGATGGCGACATTGTGCGCACCGGACAATGGGCGGTGGAGAGCTCCCCCAGCACA
TTTGCCTGCAAAGCGGGCTTTGGGCCGCAGCTCGAAGGGCTCTTTCTGCAGAGCAACCTGGGGGTAGTGACCAAG
ATGGGCCTCTGGATTCAGCCACAGCCCGAGACGACCATGACGGTGTGCTTGGAGCTGGAGCGGCTCGAGGAGCTG
GAGCAGCTGGTGGACATGATTGCTGAGCTCCGGCGCGAGGGGATTTTGCAAAACGACCCCAGCATCTTTGACGTC
TTTCGGCGCATTAGCCGGCTGGGACCAAGACACGAGGTTTATAGCGGCTCGGGGGCGATTCCAGAGGAGAGGGTG
GAGAAGCTGATGCGGGAGCAGGGCTGGGGATACTGGAAGACGTGGTTCAGTCTGTACGGGAAAAAGGACATGGTG
CTCTCGAGGCTGGGCTGGACGCAGCAGACGGTGGCAAAGAAATGCCCGACGGCGAGACTGACGTATAAGCTGTTT
GAGGGGGGCGGAGCTGGCGAGCAAGGAGTCGATCAAGGAGGCGAGCGGCGAGTGGATGCCACGAGCGTCGACGCC
GAGTGGCAGCCCATGAATGCCGGAGTGCCCTCGCTGCGCTATGCCGCCACCATTGACTACAACACGCCGCCTGGG
GGGTACGGCGGCCACATGGACTTTTCGCCCATTCTGCCCCTCGACGGCGCCATGGCGCTTGACTGGTACGGCCAA
GTGCGCTCCATTTCGCGGCAGCACGGCTTCGACAGCTTCCTCGGCGGCCATGCCTTTTCCAAGCATCTCGTGCTG
GTGCACATGATTATGTTTGACCGCCTCAACGCCGGGCAAGTGGCCAAGGCAAAGGAGCTGTGGCGGGCGCTGGCG
ACGCGCGCTCGCCAGCTGGGCTTTGCTACATATCGCACGCATCTCGACTGGATGGATTACGTCCAGGATTGCTAC
GACTTTAACCATAATGCCCAGCGGCGCTTTGTTGAGCACCTCAAGGACTCGACGGACCCCAAGGGCATTTTGTCG
CCGGGAAAGTCGGGCATTTGGCCCAAGAAGTATCGACACTTGCGCGCAGGGTAG
Transcript >OphauB2|1189
ATGTCGTCGCACCACTATCAGGCCAGGGACGTGCAAGAGGCGCATGACCGCGTCTTCAAGCCTGGCCGCACGCCT
CCCAAGCAGCAGCTGCCGCCAGGAAAGACGGCCGAGCAGCTCAAGGAGATTTTGCAGGCGCTGGCAGCCATTGTA
GGCGACGACAATGTTGGCACTGGAGAGGCACTGCTGCACTTTTCCGATCCCTTTACGCTTGAGGAATCGAGTTTT
CCTAGTGCGGCCGTATGCCCAGCTACAGTAGAAGAGATCAAGGCCATTCTAGAATACGCCAACAAGGCCGACTTT
CCCCTGTGGACAACGTCCAGAGGCAAGAATCTCGGATATGGCGGCCCGTCGCCGCGCGTCAAGGGCTCCGTGGTG
CTTTCGCTCTACCGTATGAATCGCATCCTCGAGGTGAATGAAAAAGCGGCGTATGCTGTTGTGGAGCCGGGCGTC
ACGTTTTTCGATCTCTACAACCACTGCCGAGAGCACAAGCTCTCTCTGTGGCCAAGCGTGCCTGCAATTGCTTGG
GGGAGTGTCATTGGCAATACTCTAGATCGCGGCTTTGGCTACACGGCCCTTGGAGACCACCAAAACAACATTTGC
GGCATCGAGGCCGTCTTGCCTGATGGCGACATTGTGCGCACCGGACAATGGGCGGTGGAGAGCTCCCCCAGCACA
TTTGCCTGCAAAGCGGGCTTTGGGCCGCAGCTCGAAGGGCTCTTTCTGCAGAGCAACCTGGGGGTAGTGACCAAG
ATGGGCCTCTGGATTCAGCCACAGCCCGAGACGACCATGACGGTGTGCTTGGAGCTGGAGCGGCTCGAGGAGCTG
GAGCAGCTGGTGGACATGATTGCTGAGCTCCGGCGCGAGGGGATTTTGCAAAACGACCCCAGCATCTTTGACGTC
TTTCGGCGCATTAGCCGGCTGGGACCAAGACACGAGGTTTATAGCGGCTCGGGGGCGATTCCAGAGGAGAGGGTG
GAGAAGCTGATGCGGGAGCAGGGCTGGGGATACTGGAAGACGTGGTTCAGTCTGTACGGGAAAAAGGACATGGTG
CTCTCGAGGCTGGGCTGGACGCAGCAGACGGTGGCAAAGAAATGCCCGACGGCGAGACTGACGTATAAGCTGTTT
GAGGGGGGCGGAGCTGGCGAGCAAGGAGTCGATCAAGGAGGCGAGCGGCGAGTGGATGCCACGAGCGTCGACGCC
GAGTGGCAGCCCATGAATGCCGGAGTGCCCTCGCTGCGCTATGCCGCCACCATTGACTACAACACGCCGCCTGGG
GGGTACGGCGGCCACATGGACTTTTCGCCCATTCTGCCCCTCGACGGCGCCATGGCGCTTGACTGGTACGGCCAA
GTGCGCTCCATTTCGCGGCAGCACGGCTTCGACAGCTTCCTCGGCGGCCATGCCTTTTCCAAGCATCTCGTGCTG
GTGCACATGATTATGTTTGACCGCCTCAACGCCGGGCAAGTGGCCAAGGCAAAGGAGCTGTGGCGGGCGCTGGCG
ACGCGCGCTCGCCAGCTGGGCTTTGCTACATATCGCACGCATCTCGACTGGATGGATTACGTCCAGGATTGCTAC
GACTTTAACCATAATGCCCAGCGGCGCTTTGTTGAGCACCTCAAGGACTCGACGGACCCCAAGGGCATTTTGTCG
CCGGGAAAGTCGGGCATTTGGCCCAAGAAGTATCGACACTTGCGCGCAGGGTAG
Gene >OphauB2|1189
ATGTCGTCGCACCACTATCAGGCCAGGGACGTGCAAGAGGCGCATGACCGCGTCTTCAAGCCTGGCCGCACGCCT
CCCAAGCAGCAGCTGCCGCCAGGAAAGACGGCCGAGCAGCTCAAGGAGATTTTGCAGGCGCTGGCAGCCATTGTA
GGCGACGACAATGTTGGCACTGGAGAGGCACTGCTGCACTTTTCCGATCCCTTTACGCTTGAGGAATCGAGTTTT
CCTAGTGCGGCCGTATGGTGAGAGATGAGACTTGGGTTTTTTTTTTTTCTATTTNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNTCAAATTTCCTCTATAAAAAAAATCTTCATCTTGGTCATGCTCCGGAAAAAAAAAAAATAGGGCGCATT
TTGTATGGACTCTAATGGATTTGCCGACTTGGATAAAGCCCAGCTACAGTAGAAGAGATCAAGGCCATTCTAGAA
TACGCCAACAAGGCCGACTTTCCCCTGTGGACAACGTCCAGAGGCAAGAATCTCGGGTGAGAGGCTTGTCCCGAG
CTGAGCGAGGTGTTGGGCTGATTGCTTGGGCTGATTGCTTGAGCGAATAGATATGGCGGCCCGTCGCCGCGCGTC
AAGGGCTCCGTGGTGCTTTCGCTCTACCGTATGAATCGCATCCTCGAGGTGAATGAAAAAGCGGCGTATGCTGTT
GTGGAGCCGGGCGTCACGTTTTTCGATCTCTACAACCACTGCCGAGAGCACAAGCTCTCTCTGTGGCCAAGCGTG
CCTGCAATTGCTTGGGGGAGTGTCATTGGCAATGTAGGTGGGACAATGCAACAAGAAGGATAGAGGCACAGCCAA
CGGGCAGATGCATGGGCCACATCTAACGGGCTCTTGTTAGACTCTAGATCGCGGCTTTGGCTACACGGCCCTTGG
AGACCACCAAAACAACATTTGCGGCATCGAGGCCGTCTTGCCTGATGGCGACATTGTGCGCACCGGACAATGGGC
GGTGGAGAGCTCCCCCAGCACATTTGCCTGCAAAGCGGGCTTTGGGCCGCAGCTCGAAGGGCTCTTTCTGCAGAG
CAACCTGGGGGTAGTGACCAAGATGGGCCTCTGGATTCAGCCACAGCCCGAGACGACCATGACGGTGTGCTTGGA
GCTGGAGCGGCTCGAGGAGCTGGAGCAGCTGGTGGACATGATTGCTGAGCTCCGGCGCGAGGGGATTTTGCAAAA
CGACCCCAGCATCTTTGACGTCTTTCGGCGCATTAGCCGGCTGGGACCAAGACACGAGGTTTATAGCGGCTCGGG
GGCGATTCCAGAGGAGAGGGTGGAGAAGCTGATGCGGGAGCAGGGCTGGGGATACTGGAAGACGTGGTTCAGTCT
GTACGGGAAAAAGGACATGGTGCTCTCGAGGCTGGGCTGGACGCAGCAGACGGTGGCAAAGAAATGCCCGACGGC
GAGACTGACGTATAAGCTGTTTGAGGGGGGCGGAGCTGGCGAGCAAGGAGTCGATCAAGGAGGCGAGCGGCGAGT
GGATGCCACGAGCGTCGACGCCGAGTGGCAGCCCATGAATGCCGGAGTGCCCTCGCTGCGCTATGCCGCCACCAT
TGACTACAACACGCCGCCTGGGGGGTACGGCGGCCACATGGACTTTTCGCCCATTCTGCCCCTCGACGGCGCCAT
GGCGCTTGACTGGTACGGCCAAGTGCGCTCCATTTCGCGGCAGCACGGCTTCGACAGCTTCCTCGGCGGCCATGC
CTTTTCCAAGCATCTCGTGCTGGTGCACATGATTATGTTTGACCGCCTCAACGCCGGGCAAGTGGCCAAGGCAAA
GGAGCTGTGGCGGGCGCTGGCGACGCGCGCTCGCCAGCTGGGCTTTGCTACATATCGCACGCATCTCGACTGGAT
GGGTAAGTTTGGCGGCCGTGAGAGCATGGCATTGTCTTTTAACGTGGCCTTGGGCAGATTACGTCCAGGATTGCT
ACGACTTTAACCATAATGCCCAGCGGCGCTTTGTTGAGCACCTCAAGGTATGTCGCCATGTCGAGCCCTTTTGCA
GTGCAAGCTAAGAGGCGGGCGTCGACAGGACTCGACGGACCCCAAGGGCATTTTGTCGCCGGGAAAGTCGGGCAT
TTGGCCCAAGAAGTATCGACACTTGCGCGCAGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail