Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1187
Gene name
LocationContig_13:14442..15803
Strand-
Gene length (bp)1361
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 4.7E-26 24 145
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 9.7E-12 225 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 20 315 4.0E-24
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 21 297 3.0E-23
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 42 291 7.0E-20
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 24 315 2.0E-18
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 24 315 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 20 315 4.0E-24
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 21 297 3.0E-23
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 42 291 7.0E-20
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 24 315 2.0E-18
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 24 315 2.0E-18
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 42 310 3.0E-18
sp|D4N502|DIOX3_PAPSO Codeine O-demethylase OS=Papaver somniferum GN=CODM PE=1 SV=1 23 290 6.0E-15
sp|D4N501|DIOX2_PAPSO Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase OS=Papaver somniferum GN=DIOX2 PE=2 SV=1 23 290 4.0E-12
sp|Q39224|SRG1_ARATH Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1 24 290 4.0E-12
sp|Q9C7Z1|G2OX4_ARATH Gibberellin 2-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA2OX4 PE=2 SV=1 24 290 1.0E-11
sp|D4N500|DIOX1_PAPSO Thebaine 6-O-demethylase OS=Papaver somniferum GN=T6ODM PE=1 SV=1 7 290 5.0E-11
sp|Q9M2C4|ACCH8_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 8 OS=Arabidopsis thaliana GN=At3g61400 PE=2 SV=1 23 331 6.0E-11
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Solanum lycopersicum GN=ACO2 PE=2 SV=1 42 291 3.0E-10
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 21 295 6.0E-10
sp|Q39705|ACCO2_DORSP 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Doritaenopsis sp. GN=ACO2 PE=2 SV=1 23 291 1.0E-09
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1 23 291 1.0E-09
sp|Q9LSW6|ACH10_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 10 OS=Arabidopsis thaliana GN=At5g43450 PE=2 SV=1 23 291 2.0E-09
sp|O04847|DV4H_CATRO Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2 24 343 2.0E-09
sp|Q9XFR9|G2OX2_ARATH Gibberellin 2-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA2OX2 PE=2 SV=1 151 291 3.0E-09
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1 25 291 4.0E-09
sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1 4 290 4.0E-09
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 16 291 4.0E-09
sp|Q06588|ACCO4_ARATH 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Arabidopsis thaliana GN=ACO4 PE=1 SV=2 21 291 6.0E-09
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 22 291 7.0E-09
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 137 342 8.0E-09
sp|Q8H1S4|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 3 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1 143 291 1.0E-08
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 22 291 1.0E-08
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 36 291 1.0E-08
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 13 291 2.0E-08
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 42 291 2.0E-08
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 42 291 3.0E-08
sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase OS=Musa acuminata GN=MAO1B PE=3 SV=1 23 291 4.0E-08
sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase OS=Prunus mume GN=ACO1 PE=2 SV=1 36 291 5.0E-08
sp|Q00985|ACCO1_MALDO 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Malus domestica PE=1 SV=1 21 291 5.0E-08
sp|Q9FZ21|G2OX6_ARATH Gibberellin 2-beta-dioxygenase 6 OS=Arabidopsis thaliana GN=GA2OX6 PE=2 SV=1 4 291 5.0E-08
sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Malus domestica GN=ACO2 PE=2 SV=1 21 291 6.0E-08
sp|Q84MB3|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1 23 315 7.0E-08
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 22 291 7.0E-08
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 25 291 7.0E-08
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 25 291 7.0E-08
sp|Q84TC2|BX6_MAIZE DIBOA-glucoside dioxygenase BX6 OS=Zea mays GN=BX6 PE=1 SV=1 22 291 8.0E-08
sp|P31528|ACCO_DIACA Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1 38 291 8.0E-08
sp|Q9C5K7|ACCH2_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1 143 291 1.0E-07
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1 42 291 1.0E-07
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 151 291 1.0E-07
sp|Q9XHM5|G2OX2_PEA Gibberellin 2-beta-dioxygenase 2 OS=Pisum sativum GN=GA2OX2 PE=2 SV=1 24 291 1.0E-07
sp|P93824|ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6 OS=Arabidopsis thaliana GN=At1g04350 PE=2 SV=1 23 291 2.0E-07
sp|Q40062|IDS3_HORVU 2'-deoxymugineic-acid 2'-dioxygenase OS=Hordeum vulgare GN=IDS3 PE=1 SV=3 140 290 2.0E-07
sp|Q43792|ACCO_TOBAC 1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1 42 291 2.0E-07
sp|P08703|IPNS_PENCH Isopenicillin N synthase OS=Penicillium chrysogenum GN=pcbC PE=3 SV=1 39 291 2.0E-07
sp|P24397|HY6H_HYONI Hyoscyamine 6-dioxygenase OS=Hyoscyamus niger GN=H6H PE=1 SV=1 22 311 3.0E-07
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase OS=Persea americana GN=ACO PE=2 SV=1 225 291 3.0E-07
sp|Q40061|IDS2_HORVU Mugineic-acid 3-dioxygenase OS=Hordeum vulgare GN=IDS2 PE=2 SV=1 141 290 4.0E-07
sp|P05116|ACCO1_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2 42 291 6.0E-07
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 227 315 7.0E-07
sp|Q04644|ACCO1_CUCME 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1 41 291 7.0E-07
sp|Q7XZQ8|FNSI_PETCR Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1 16 282 7.0E-07
sp|P05326|IPNS_EMENI Isopenicillin N synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ipnA PE=1 SV=1 22 291 1.0E-06
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 21 291 1.0E-06
sp|Q9LTH8|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11 OS=Arabidopsis thaliana GN=At5g59530 PE=2 SV=1 24 355 2.0E-06
sp|O24648|G3OX_PEA Gibberellin 3-beta-dioxygenase 1 OS=Pisum sativum GN=LE PE=1 SV=1 142 291 2.0E-06
sp|Q9LTH7|ACH12_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 12 OS=Arabidopsis thaliana GN=At5g59540 PE=2 SV=1 24 291 2.0E-06
sp|Q43383|ACCH5_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 5 OS=Arabidopsis thaliana GN=2A6 PE=2 SV=2 143 315 2.0E-06
sp|Q9LSW7|ACCH9_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 9 OS=Arabidopsis thaliana GN=At5g43440 PE=2 SV=1 23 315 3.0E-06
sp|P16020|IPNS_FLASS Isopenicillin N synthase OS=Flavobacterium sp. (strain SC 12,154) GN=pcbC PE=3 SV=1 142 291 3.0E-06
sp|Q48739|IPNS_LYSLA Isopenicillin N synthase OS=Lysobacter lactamgenus GN=pcbC PE=3 SV=1 142 291 3.0E-06
sp|P05189|IPNS_ACRCH Isopenicillin N synthase OS=Acremonium chrysogenum GN=PCBC PE=1 SV=1 142 291 4.0E-06
sp|P27744|IPNS_AMYLA Isopenicillin N synthase OS=Amycolatopsis lactamdurans GN=pcbC PE=3 SV=1 22 293 6.0E-06
sp|Q94A78|ACCH4_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g03400 PE=2 SV=1 143 291 7.0E-06
sp|P31239|ACCO_PEA 1-aminocyclopropane-1-carboxylate oxidase OS=Pisum sativum GN=ACO PE=2 SV=1 225 291 8.0E-06
sp|P18286|IPNS_STRJU Isopenicillin N synthase OS=Streptomyces jumonjinensis GN=pcbC PE=3 SV=1 22 293 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1187
MTETRPLVPQARHTLVAQETFSSIPVLDFRLSQSPESKPLFLSQLREALVIVGFFYLKNPPVPQHVRNSFVEKSI
ELCDLPLDKKLKIDMINSKHFLGYSRRGLEKTARRTDNREMFDFLTPLPAPGPDEPIYLNVQGPSQWPEEQDVPG
FRPAIENYLFSIGELGKTMTSLVAEALDLEPSAFTHLFNRDVPRNKVSLLKYPEPADDSDASPGLIQDINSDGSF
QGVGPHKDGGFLTFLLQATAHAGLEAQNKAGRWISIPPIPNTLVINVGRSLESLTAGVCTATTHRVNLRPSFFFD
RHGRCLGPRYSYPVFQTLRVDVTHQELTSIKLPKHITDLVKDEKIKSDAEAYFAKYHLQSPGKGIFMARLTSHPE
VGRRWYPEQLAEALKGQREFSS*
Coding >OphauB2|1187
ATGACAGAGACCAGGCCCTTGGTGCCCCAGGCTCGCCACACGCTTGTGGCTCAGGAGACCTTTTCCTCCATTCCT
GTGCTTGATTTTCGTCTGTCTCAGTCGCCAGAATCAAAGCCCCTTTTCCTTTCACAACTCCGCGAAGCTCTAGTC
ATTGTCGGTTTCTTCTATCTCAAGAACCCCCCCGTGCCTCAGCATGTGCGAAATTCATTCGTTGAAAAGTCGATT
GAGCTGTGCGACTTGCCGCTAGACAAGAAGCTCAAAATTGACATGATTAACAGCAAACATTTCCTCGGCTACTCC
CGCAGAGGCCTGGAGAAGACGGCCCGCAGGACTGACAATCGAGAAATGTTTGACTTTCTGACGCCATTGCCCGCT
CCGGGTCCAGACGAGCCCATCTATCTCAATGTTCAAGGCCCAAGCCAGTGGCCAGAAGAGCAAGATGTCCCTGGC
TTCCGTCCCGCCATTGAAAACTATCTCTTCTCCATTGGTGAGCTTGGCAAGACCATGACAAGCCTCGTGGCCGAG
GCACTGGACCTGGAGCCCTCAGCCTTTACCCATCTCTTCAACAGAGACGTCCCAAGGAACAAGGTGTCGTTGCTC
AAGTACCCGGAGCCGGCAGACGACTCGGACGCGTCGCCAGGCTTGATTCAAGACATCAACAGCGACGGCAGCTTC
CAGGGCGTCGGGCCGCACAAGGACGGCGGCTTCCTCACCTTTTTGCTGCAAGCCACCGCCCACGCGGGCCTCGAG
GCGCAAAACAAGGCGGGCCGCTGGATCTCCATCCCCCCAATTCCCAACACGCTCGTCATCAACGTTGGCCGCTCG
CTCGAGTCGCTGACGGCCGGCGTCTGCACCGCAACCACTCACCGCGTCAACCTCCGTCCTTCCTTCTTCTTTGAC
AGACACGGCCGGTGTCTGGGCCCGCGCTACTCGTATCCCGTCTTCCAAACCCTGCGCGTCGACGTGACACACCAA
GAGCTCACGTCGATTAAACTGCCAAAGCACATTACCGACCTGGTCAAGGACGAAAAGATCAAGTCGGATGCCGAG
GCCTACTTTGCCAAGTATCATCTCCAGAGTCCAGGAAAGGGCATCTTCATGGCCAGACTGACGAGCCATCCCGAG
GTTGGTCGCAGATGGTACCCAGAGCAGCTGGCCGAGGCGCTCAAGGGGCAGCGAGAGTTTTCTTCCTAG
Transcript >OphauB2|1187
ATGACAGAGACCAGGCCCTTGGTGCCCCAGGCTCGCCACACGCTTGTGGCTCAGGAGACCTTTTCCTCCATTCCT
GTGCTTGATTTTCGTCTGTCTCAGTCGCCAGAATCAAAGCCCCTTTTCCTTTCACAACTCCGCGAAGCTCTAGTC
ATTGTCGGTTTCTTCTATCTCAAGAACCCCCCCGTGCCTCAGCATGTGCGAAATTCATTCGTTGAAAAGTCGATT
GAGCTGTGCGACTTGCCGCTAGACAAGAAGCTCAAAATTGACATGATTAACAGCAAACATTTCCTCGGCTACTCC
CGCAGAGGCCTGGAGAAGACGGCCCGCAGGACTGACAATCGAGAAATGTTTGACTTTCTGACGCCATTGCCCGCT
CCGGGTCCAGACGAGCCCATCTATCTCAATGTTCAAGGCCCAAGCCAGTGGCCAGAAGAGCAAGATGTCCCTGGC
TTCCGTCCCGCCATTGAAAACTATCTCTTCTCCATTGGTGAGCTTGGCAAGACCATGACAAGCCTCGTGGCCGAG
GCACTGGACCTGGAGCCCTCAGCCTTTACCCATCTCTTCAACAGAGACGTCCCAAGGAACAAGGTGTCGTTGCTC
AAGTACCCGGAGCCGGCAGACGACTCGGACGCGTCGCCAGGCTTGATTCAAGACATCAACAGCGACGGCAGCTTC
CAGGGCGTCGGGCCGCACAAGGACGGCGGCTTCCTCACCTTTTTGCTGCAAGCCACCGCCCACGCGGGCCTCGAG
GCGCAAAACAAGGCGGGCCGCTGGATCTCCATCCCCCCAATTCCCAACACGCTCGTCATCAACGTTGGCCGCTCG
CTCGAGTCGCTGACGGCCGGCGTCTGCACCGCAACCACTCACCGCGTCAACCTCCGTCCTTCCTTCTTCTTTGAC
AGACACGGCCGGTGTCTGGGCCCGCGCTACTCGTATCCCGTCTTCCAAACCCTGCGCGTCGACGTGACACACCAA
GAGCTCACGTCGATTAAACTGCCAAAGCACATTACCGACCTGGTCAAGGACGAAAAGATCAAGTCGGATGCCGAG
GCCTACTTTGCCAAGTATCATCTCCAGAGTCCAGGAAAGGGCATCTTCATGGCCAGACTGACGAGCCATCCCGAG
GTTGGTCGCAGATGGTACCCAGAGCAGCTGGCCGAGGCGCTCAAGGGGCAGCGAGAGTTTTCTTCCTAG
Gene >OphauB2|1187
ATGACAGAGACCAGGCCCTTGGTGCCCCAGGCTCGCCACACGCTTGTGGCTCAGGAGACCTTTTCCTCCATTCCT
GTGCTTGATTTTCGTCTGTCTCAGTCGCCAGAATCAAAGCCCCTTTTCCTTTCACAACTCCGCGAAGCTCTAGTC
ATTGTCGGTTTCTTCTATCTCAAGAACCCCCCCGTGCCTCAGCATGTGCGAAATTCATTCGTTGAAAAGTCGATT
GAGCTGTGCGACTTGCCGCTAGACAAGAAGCTCAAAATTGACATGATTAACAGCAAACATTTCCTCGGCTACTCC
CGCAGAGGCCTGGAGAAGACGGCCCGCAGGACTGACAATCGAGAAATGTTTGACGTGAGTCAAGAGTCGCCTTTT
TCATCTCTTGTAATCATGGGCTGAACTCTGCCTCTTCTCGTCATAGTTTCTGACGCCATTGCCCGCTCCGGGTCC
AGACGAGCCCATCTATCTCAATGTTCAAGGCCCAAGCCAGGTATGCTTTTTTGTTTTTGTTTTTTTTCATGCTTT
TTTGGCGTCGTCGTCTGTCTGGAGCTGAGCCCAACTCACAAAATCTTTGTTTTCCCTCAATCAAGTGGCCAGAAG
AGCAAGATGTCCCTGGCTTCCGTCCCGCCATTGAAAACTATCTCTTCTCCATTGGTGAGCTTGGCAAGACCATGA
CAAGCCTCGTGGCCGAGGCACTGGACCTGGAGCCCTCAGCCTTTACCCATCTCTTCAACAGAGACGTCCCAAGGA
ACAAGGTGTCGTTGCTCAAGTACCCGGAGCCGGCAGACGACTCGGACGCGTCGCCAGGCTTGATTCAAGACATCA
ACAGCGACGGCAGCTTCCAGGGCGTCGGGCCGCACAAGGACGGCGGCTTCCTCACCTTTTTGCTGCAAGCCACCG
CCCACGCGGGCCTCGAGGCGCAAAACAAGGCGGGCCGCTGGATCTCCATCCCCCCAATTCCCAACACGCTCGTCA
TCAACGTTGGCCGCTCGCTCGAGTCGCTGACGGCCGGCGTCTGCACCGCAACCACTCACCGCGTCAACCTCCGTC
CTTCCTTCTTCTTTGACAGACACGGCCGGTGTCTGGGCCCGCGCTACTCGTATCCCGTCTTCCAAACCCTGCGCG
TCGACGTGACACACCAAGAGCTCACGTCGATTAAACTGCCAAAGCACATTACCGACCTGGTCAAGGACGAAAAGA
TCAAGTCGGATGCCGAGGCCTACTTTGCCAAGTATCATCTCCAGAGTCCAGGAAAGGGCATCTTCATGGCCAGAC
TGACGAGCCATCCCGAGGTTGGTCGCAGATGGTACCCAGAGCAGCTGGCCGAGGCGCTCAAGGGGCAGCGAGAGT
TTTCTTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail