Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1183
Gene name
LocationContig_13:1701..4805
Strand-
Gene length (bp)3104
Transcript length (bp)2982
Coding sequence length (bp)2982
Protein length (aa) 994

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.3E-10 348 467
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 7.1E-08 345 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LFP7|Y5158_ARATH Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=2 SV=1 360 578 3.0E-11
sp|Q9SRH7|Y3130_ARATH Receptor-like serine/threonine-protein kinase At3g01300 OS=Arabidopsis thaliana GN=At3g01300 PE=2 SV=1 360 578 6.0E-10
sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=1 SV=2 360 571 4.0E-09
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 334 560 5.0E-09
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 364 559 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LFP7|Y5158_ARATH Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=2 SV=1 360 578 3.0E-11
sp|Q9SRH7|Y3130_ARATH Receptor-like serine/threonine-protein kinase At3g01300 OS=Arabidopsis thaliana GN=At3g01300 PE=2 SV=1 360 578 6.0E-10
sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=1 SV=2 360 571 4.0E-09
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 334 560 5.0E-09
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 364 559 7.0E-09
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 320 574 2.0E-08
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 329 560 3.0E-08
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 358 511 5.0E-08
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 338 511 9.0E-08
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 335 521 1.0E-07
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 335 521 1.0E-07
sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1 360 511 2.0E-07
sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) GN=V-SRC PE=1 SV=3 346 508 2.0E-07
sp|O54967|ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus GN=Tnk2 PE=1 SV=2 348 518 2.0E-07
sp|P63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Schmidt-Ruppin E) GN=V-SRC PE=1 SV=3 346 508 2.0E-07
sp|Q9LTC0|Y5707_ARATH Probable receptor-like protein kinase At5g47070 OS=Arabidopsis thaliana GN=At5g47070 PE=1 SV=1 360 552 2.0E-07
sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2 360 508 3.0E-07
sp|P00526|SRC_RSVP Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Prague C) GN=V-SRC PE=1 SV=3 346 508 3.0E-07
sp|Q9LFH9|LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana GN=LECRK81 PE=2 SV=1 304 532 3.0E-07
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 334 539 7.0E-07
sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 335 569 1.0E-06
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 346 512 1.0E-06
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 364 521 5.0E-06
sp|H2KZU7|SVH2_CAEEL Tyrosine-protein kinase receptor svh-2 OS=Caenorhabditis elegans GN=svh-2 PE=1 SV=1 358 567 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1183
MALSHHTASEHLSAARPHFWQRLMNRQAPSSCSLAGEPCQPPRPALDAAPELPTPPSFPRQVVVGLPRAPTFSRQ
QSEQRKHLVPVIPSPDERRAVSADRRSRSWYRRVPSLPKADVRLSAPSLVGTDLQDAPHYDAQPSYHDEYHDRPG
TASEAESVTGSSRDSEHMFDHDMPVDAPPSVTTSRHEAMINDELDTTWILNLSMQFRDLSRREKFFVTYREQEHH
WRRVTISLDYRDAPPNSLERDLLQMDLLRTGNQRQKIAKIYEAIRESIPDIQFYDTVTNLKLETTNGRLHVHVVQ
DGQEIIRYPRVSHLRHLGCRRVRESEIFFDSHMSGFVYKVRVHGHVLIKKEIPSQDTIDEFLYEVNALNSLRHTR
DVVKFYGVVVDDHDEFVKGLLISYASRGALIDLIFERCKGKRFKIPWTTKERWARQMMQGLADIHEAGFVQGDFT
LSNIVIDEAGNAKIIDINRRGCPMGWEPPEATPIVEAGHRITMYIGIKSDLYQLGMVLWALAMEYYEPEACRRPL
LLDAKVEVPDWYRQITEICLSTDPRMRLQASTLLDLLPPSIKLDQVISSKEFLSVDDGHSFNQYLVDGLHTGGRL
HVKPAVNRDGWPYSGRTYVDSSPERQEQYYQLRGRSPPSGLPSDADGCEATRDPVSQTSWAANRSVRPSYTDVEE
PSSLREDASLLGEERSMTQSTAEEGIGFVDTNDGFLCDDNNGAWGHRDLLVPPSDDENLDNIYFPVPTYPSPAAF
CLGIPAPSRSEGCTEQYPQASQGFKMGHADTSITKANECSPSDTIGIAPATCQSSLTVAACSTSHAARVEAEAAI
ENTSRLVLPVKRRREATGKASRDGEQGNATSPMTEPPSKAQSPTQTHGDGRPGHAEDMTAATTAGSTGPPSRQTS
LNLVDQKTMSDRPYFQPVYKNSSANEKWPSLMGSEEPLNVEQMPGHLEHKSLAMSLAGIGAAHMGFNDEPMREMA
FSMDDEFETIGRPSPMMI*
Coding >OphauB2|1183
ATGGCCTTGTCACACCATACCGCATCAGAGCATCTGTCGGCAGCAAGACCTCATTTTTGGCAAAGACTTATGAAT
AGACAAGCCCCTTCGTCATGCTCCCTTGCTGGAGAGCCTTGCCAGCCACCGAGGCCCGCCCTCGACGCCGCTCCA
GAGCTTCCTACGCCTCCATCTTTTCCCCGCCAAGTTGTTGTCGGCCTTCCTAGAGCCCCAACATTTAGCAGACAA
CAGTCGGAGCAGCGCAAGCACCTTGTCCCCGTTATTCCTTCCCCAGATGAGCGCCGAGCAGTCTCGGCAGATCGC
CGCTCTCGCAGCTGGTATCGTCGGGTTCCTTCGCTGCCCAAAGCAGACGTGAGACTCAGCGCCCCTAGCCTAGTT
GGCACCGACCTTCAAGATGCACCTCATTATGATGCGCAGCCCTCGTATCATGATGAATATCATGATCGACCTGGC
ACCGCCTCGGAAGCCGAGTCGGTTACTGGATCAAGTAGGGATTCTGAGCACATGTTTGATCATGACATGCCTGTC
GACGCGCCACCCTCAGTCACTACCTCACGCCACGAGGCAATGATTAATGATGAGCTTGACACAACCTGGATACTT
AACCTCAGCATGCAATTTCGAGACCTTTCCCGCAGGGAAAAGTTCTTTGTTACCTATCGTGAACAGGAGCATCAC
TGGAGGCGAGTCACCATCTCGCTCGATTATCGCGATGCCCCTCCAAACTCCCTGGAAAGGGATCTCTTACAGATG
GATCTCCTTCGCACTGGAAATCAGCGTCAAAAAATTGCAAAGATTTATGAAGCCATCCGCGAAAGCATTCCAGAT
ATTCAGTTCTACGACACTGTAACAAATCTCAAACTTGAGACGACAAACGGCCGTCTCCACGTCCATGTTGTGCAA
GACGGACAAGAAATCATCAGATATCCTCGTGTCAGTCATTTGCGGCACTTAGGCTGCCGAAGAGTGCGAGAGAGT
GAAATCTTCTTTGATTCGCACATGTCGGGATTTGTTTACAAAGTCAGGGTACATGGTCATGTTCTAATCAAGAAA
GAAATTCCCAGTCAAGACACCATTGATGAATTTCTGTACGAAGTCAACGCTCTCAACAGTCTGAGACACACTAGG
GATGTCGTCAAGTTCTACGGAGTCGTTGTGGACGACCATGATGAATTTGTCAAGGGCTTGCTGATTTCGTACGCA
TCTCGAGGAGCTCTCATCGACCTCATTTTTGAGCGATGCAAAGGAAAACGTTTCAAGATTCCCTGGACAACCAAA
GAACGGTGGGCGCGGCAAATGATGCAGGGACTAGCAGATATACATGAGGCTGGCTTTGTCCAGGGCGATTTCACT
CTTTCAAACATCGTCATTGACGAGGCTGGAAATGCCAAGATTATAGACATCAATAGGCGCGGCTGTCCCATGGGG
TGGGAGCCACCCGAGGCGACTCCAATAGTCGAGGCAGGTCATCGCATTACCATGTACATTGGCATCAAGTCCGAC
TTGTACCAACTAGGCATGGTTCTTTGGGCTTTGGCAATGGAATACTATGAGCCAGAAGCATGCCGTCGACCACTG
CTTCTGGATGCCAAAGTTGAAGTGCCAGATTGGTACCGACAGATAACAGAGATATGCCTGAGCACCGACCCGAGA
ATGCGCCTCCAGGCATCTACGTTGCTTGATCTGCTGCCCCCTTCAATCAAGCTAGACCAGGTCATTTCATCTAAA
GAGTTCTTGTCAGTCGACGATGGTCATTCATTCAATCAGTACCTTGTGGATGGCCTTCACACAGGGGGCAGGCTC
CACGTGAAGCCGGCTGTAAACCGCGATGGCTGGCCTTATTCAGGCAGAACATACGTCGACTCAAGTCCCGAACGA
CAGGAACAGTATTATCAACTTCGTGGCCGCTCACCGCCAAGCGGGCTGCCGAGCGACGCTGACGGCTGTGAGGCA
ACACGGGACCCCGTGAGCCAAACTTCTTGGGCGGCGAATAGGAGCGTTCGGCCGTCGTACACAGATGTTGAGGAA
CCCAGTTCTTTGCGGGAAGATGCATCACTATTGGGGGAGGAAAGGAGCATGACGCAGTCGACGGCGGAAGAAGGG
ATTGGTTTTGTCGACACCAATGATGGATTCCTGTGCGACGACAATAATGGCGCATGGGGGCATCGAGATCTGTTG
GTTCCGCCAAGCGACGATGAGAACTTAGATAACATCTACTTTCCAGTTCCGACGTATCCTTCACCGGCCGCGTTT
TGCTTGGGTATACCAGCACCGAGCCGGTCTGAGGGCTGCACTGAACAGTACCCACAGGCGTCACAGGGTTTCAAA
ATGGGTCACGCGGACACGAGTATCACGAAAGCTAATGAATGCAGCCCAAGCGACACGATTGGAATAGCCCCTGCA
ACCTGCCAGAGCTCGCTGACTGTGGCAGCTTGTTCCACAAGTCATGCTGCACGGGTCGAGGCCGAGGCTGCCATT
GAAAATACAAGCCGGTTGGTCTTGCCGGTCAAGCGCAGACGGGAGGCAACAGGAAAAGCATCACGAGATGGCGAA
CAAGGCAATGCAACCTCGCCAATGACAGAACCCCCTTCGAAGGCACAGAGTCCGACACAGACGCACGGAGATGGA
CGACCAGGTCATGCCGAAGACATGACAGCAGCAACAACAGCAGGTAGCACGGGACCGCCTAGCAGACAGACTAGT
CTAAATCTGGTGGATCAGAAAACCATGTCTGACAGGCCATACTTTCAACCAGTCTATAAGAATTCTTCTGCAAAC
GAAAAATGGCCCTCGTTGATGGGTTCGGAGGAGCCTTTGAACGTGGAGCAAATGCCAGGACATCTCGAGCATAAA
AGTCTCGCAATGTCGCTGGCGGGTATCGGTGCGGCACACATGGGCTTCAACGATGAGCCAATGCGTGAAATGGCC
TTTAGCATGGATGATGAATTTGAAACGATTGGGAGACCCAGTCCCATGATGATATGA
Transcript >OphauB2|1183
ATGGCCTTGTCACACCATACCGCATCAGAGCATCTGTCGGCAGCAAGACCTCATTTTTGGCAAAGACTTATGAAT
AGACAAGCCCCTTCGTCATGCTCCCTTGCTGGAGAGCCTTGCCAGCCACCGAGGCCCGCCCTCGACGCCGCTCCA
GAGCTTCCTACGCCTCCATCTTTTCCCCGCCAAGTTGTTGTCGGCCTTCCTAGAGCCCCAACATTTAGCAGACAA
CAGTCGGAGCAGCGCAAGCACCTTGTCCCCGTTATTCCTTCCCCAGATGAGCGCCGAGCAGTCTCGGCAGATCGC
CGCTCTCGCAGCTGGTATCGTCGGGTTCCTTCGCTGCCCAAAGCAGACGTGAGACTCAGCGCCCCTAGCCTAGTT
GGCACCGACCTTCAAGATGCACCTCATTATGATGCGCAGCCCTCGTATCATGATGAATATCATGATCGACCTGGC
ACCGCCTCGGAAGCCGAGTCGGTTACTGGATCAAGTAGGGATTCTGAGCACATGTTTGATCATGACATGCCTGTC
GACGCGCCACCCTCAGTCACTACCTCACGCCACGAGGCAATGATTAATGATGAGCTTGACACAACCTGGATACTT
AACCTCAGCATGCAATTTCGAGACCTTTCCCGCAGGGAAAAGTTCTTTGTTACCTATCGTGAACAGGAGCATCAC
TGGAGGCGAGTCACCATCTCGCTCGATTATCGCGATGCCCCTCCAAACTCCCTGGAAAGGGATCTCTTACAGATG
GATCTCCTTCGCACTGGAAATCAGCGTCAAAAAATTGCAAAGATTTATGAAGCCATCCGCGAAAGCATTCCAGAT
ATTCAGTTCTACGACACTGTAACAAATCTCAAACTTGAGACGACAAACGGCCGTCTCCACGTCCATGTTGTGCAA
GACGGACAAGAAATCATCAGATATCCTCGTGTCAGTCATTTGCGGCACTTAGGCTGCCGAAGAGTGCGAGAGAGT
GAAATCTTCTTTGATTCGCACATGTCGGGATTTGTTTACAAAGTCAGGGTACATGGTCATGTTCTAATCAAGAAA
GAAATTCCCAGTCAAGACACCATTGATGAATTTCTGTACGAAGTCAACGCTCTCAACAGTCTGAGACACACTAGG
GATGTCGTCAAGTTCTACGGAGTCGTTGTGGACGACCATGATGAATTTGTCAAGGGCTTGCTGATTTCGTACGCA
TCTCGAGGAGCTCTCATCGACCTCATTTTTGAGCGATGCAAAGGAAAACGTTTCAAGATTCCCTGGACAACCAAA
GAACGGTGGGCGCGGCAAATGATGCAGGGACTAGCAGATATACATGAGGCTGGCTTTGTCCAGGGCGATTTCACT
CTTTCAAACATCGTCATTGACGAGGCTGGAAATGCCAAGATTATAGACATCAATAGGCGCGGCTGTCCCATGGGG
TGGGAGCCACCCGAGGCGACTCCAATAGTCGAGGCAGGTCATCGCATTACCATGTACATTGGCATCAAGTCCGAC
TTGTACCAACTAGGCATGGTTCTTTGGGCTTTGGCAATGGAATACTATGAGCCAGAAGCATGCCGTCGACCACTG
CTTCTGGATGCCAAAGTTGAAGTGCCAGATTGGTACCGACAGATAACAGAGATATGCCTGAGCACCGACCCGAGA
ATGCGCCTCCAGGCATCTACGTTGCTTGATCTGCTGCCCCCTTCAATCAAGCTAGACCAGGTCATTTCATCTAAA
GAGTTCTTGTCAGTCGACGATGGTCATTCATTCAATCAGTACCTTGTGGATGGCCTTCACACAGGGGGCAGGCTC
CACGTGAAGCCGGCTGTAAACCGCGATGGCTGGCCTTATTCAGGCAGAACATACGTCGACTCAAGTCCCGAACGA
CAGGAACAGTATTATCAACTTCGTGGCCGCTCACCGCCAAGCGGGCTGCCGAGCGACGCTGACGGCTGTGAGGCA
ACACGGGACCCCGTGAGCCAAACTTCTTGGGCGGCGAATAGGAGCGTTCGGCCGTCGTACACAGATGTTGAGGAA
CCCAGTTCTTTGCGGGAAGATGCATCACTATTGGGGGAGGAAAGGAGCATGACGCAGTCGACGGCGGAAGAAGGG
ATTGGTTTTGTCGACACCAATGATGGATTCCTGTGCGACGACAATAATGGCGCATGGGGGCATCGAGATCTGTTG
GTTCCGCCAAGCGACGATGAGAACTTAGATAACATCTACTTTCCAGTTCCGACGTATCCTTCACCGGCCGCGTTT
TGCTTGGGTATACCAGCACCGAGCCGGTCTGAGGGCTGCACTGAACAGTACCCACAGGCGTCACAGGGTTTCAAA
ATGGGTCACGCGGACACGAGTATCACGAAAGCTAATGAATGCAGCCCAAGCGACACGATTGGAATAGCCCCTGCA
ACCTGCCAGAGCTCGCTGACTGTGGCAGCTTGTTCCACAAGTCATGCTGCACGGGTCGAGGCCGAGGCTGCCATT
GAAAATACAAGCCGGTTGGTCTTGCCGGTCAAGCGCAGACGGGAGGCAACAGGAAAAGCATCACGAGATGGCGAA
CAAGGCAATGCAACCTCGCCAATGACAGAACCCCCTTCGAAGGCACAGAGTCCGACACAGACGCACGGAGATGGA
CGACCAGGTCATGCCGAAGACATGACAGCAGCAACAACAGCAGGTAGCACGGGACCGCCTAGCAGACAGACTAGT
CTAAATCTGGTGGATCAGAAAACCATGTCTGACAGGCCATACTTTCAACCAGTCTATAAGAATTCTTCTGCAAAC
GAAAAATGGCCCTCGTTGATGGGTTCGGAGGAGCCTTTGAACGTGGAGCAAATGCCAGGACATCTCGAGCATAAA
AGTCTCGCAATGTCGCTGGCGGGTATCGGTGCGGCACACATGGGCTTCAACGATGAGCCAATGCGTGAAATGGCC
TTTAGCATGGATGATGAATTTGAAACGATTGGGAGACCCAGTCCCATGATGATATGA
Gene >OphauB2|1183
ATGGCCTTGTCACACCATACCGCATCAGAGCATCTGTCGGCAGCAAGACCTCATTTTTGGCAAAGACTTATGAAT
AGACAAGCCCCTTCGTCATGCTCCCTTGCTGGAGAGCCTTGCCAGCCACCGAGGCCCGCCCTCGACGCCGCTCCA
GAGCTTCCTACGCCTCCATCTTTTCCCCGCCAAGTTGTTGTCGGCCTTCCTAGAGCCCCAACATTTAGCAGACAA
CAGTCGGAGCAGCGCAAGCACCTTGTCCCCGTTATTCCTTCCCCAGATGAGCGCCGAGCAGTCTCGGCAGATCGC
CGCTCTCGCAGCTGGTATCGTCGGGTTCCTTCGCTGCCCAAAGCAGACGTGAGACTCAGCGCCCCTAGCCTAGTT
GGCACCGACCTTCAAGATGCACCTCATTATGATGCGCAGCCCTCGTATCATGATGAATATCATGATCGACCTGGC
ACCGCCTCGGAAGCCGAGTCGGTTACTGGATCAAGTAGGGATTCTGAGCACATGTTTGATCATGACATGCCTGTC
GACGCGCCACCCTCAGTCACTACCTCACGCCACGAGGCAATGATTAATGATGAGCTTGACACAACCTGGATACTT
AACCTCAGCATGCAATTTCGAGACCTTTCCCGCAGGGAAAAGTTCTTTGTTACCTATCGTGAACAGGAGCATCAC
TGGAGGCGAGTCACCATCTCGCTCGATTATCGCGATGCCCCTCCAAACTCCCTGGAAAGGGATCTCTTACAGATG
GATCTCCTTCGCACTGGAAATCAGCGTCAAAAAATTGCAAAGATTTATGAAGCCATCCGCGAAAGCATTCCAGAT
ATTCAGTTCTACGACACTGTAACAAATCTCAAACTTGAGACGACAAACGGCCGTCTCCACGTCCATGTTGTGCAA
GACGGACAAGTAAGTCGATCCATGAATAATAACGCGTCGCCTCAATTTCGGCCTGCAGCACCTCCATTCTTTCAA
CACAGCTCTTTGGCAAATCTCTTGTTTTCTTGTCGACTAACGCATCAATATCTTAGGAAATCATCAGATATCCTC
GTGTCAGTCATTTGCGGCACTTAGGCTGCCGAAGAGTGCGAGAGAGTGAAATCTTCTTTGATTCGCACATGTCGG
GATTTGTTTACAAAGTCAGGGTACATGGTCATGTTCTAATCAAGAAAGAAATTCCCAGTCAAGACACCATTGATG
AATTTCTGTACGAAGTCAACGCTCTCAACAGTCTGAGACACACTAGGGATGTCGTCAAGTTCTACGGAGTCGTTG
TGGACGACCATGATGAATTTGTCAAGGGCTTGCTGATTTCGTACGCATCTCGAGGAGCTCTCATCGACCTCATTT
TTGAGCGATGCAAAGGAAAACGTTTCAAGATTCCCTGGACAACCAAAGAACGGTGGGCGCGGCAAATGATGCAGG
GACTAGCAGATATACATGAGGCTGGCTTTGTCCAGGGCGATTTCACTCTTTCAAACATCGTCATTGACGAGGCTG
GAAATGCCAAGATTATAGACATCAATAGGCGCGGCTGTCCCATGGGGTGGGAGCCACCCGAGGCGACTCCAATAG
TCGAGGCAGGTCATCGCATTACCATGTACATTGGCATCAAGTCCGACTTGTACCAACTAGGCATGGTTCTTTGGG
CTTTGGCAATGGAATACTATGAGCCAGAAGCATGCCGTCGACCACTGCTTCTGGATGCCAAAGTTGAAGTGCCAG
ATTGGTACCGACAGATAACAGAGATATGCCTGAGCACCGACCCGAGAATGCGCCTCCAGGCATCTACGTTGCTTG
ATCTGCTGCCCCCTTCAATCAAGCTAGACCAGGTCATTTCATCTAAAGAGTTCTTGTCAGTCGACGATGGTCATT
CATTCAATCAGTACCTTGTGGATGGCCTTCACACAGGGGGCAGGCTCCACGTGAAGCCGGCTGTAAACCGCGATG
GCTGGCCTTATTCAGGCAGAACATACGTCGACTCAAGTCCCGAACGACAGGAACAGTATTATCAACTTCGTGGCC
GCTCACCGCCAAGCGGGCTGCCGAGCGACGCTGACGGCTGTGAGGCAACACGGGACCCCGTGAGCCAAACTTCTT
GGGCGGCGAATAGGAGCGTTCGGCCGTCGTACACAGATGTTGAGGAACCCAGTTCTTTGCGGGAAGATGCATCAC
TATTGGGGGAGGAAAGGAGCATGACGCAGTCGACGGCGGAAGAAGGGATTGGTTTTGTCGACACCAATGATGGAT
TCCTGTGCGACGACAATAATGGCGCATGGGGGCATCGAGATCTGTTGGTTCCGCCAAGCGACGATGAGAACTTAG
ATAACATCTACTTTCCAGTTCCGACGTATCCTTCACCGGCCGCGTTTTGCTTGGGTATACCAGCACCGAGCCGGT
CTGAGGGCTGCACTGAACAGTACCCACAGGCGTCACAGGGTTTCAAAATGGGTCACGCGGACACGAGTATCACGA
AAGCTAATGAATGCAGCCCAAGCGACACGATTGGAATAGCCCCTGCAACCTGCCAGAGCTCGCTGACTGTGGCAG
CTTGTTCCACAAGTCATGCTGCACGGGTCGAGGCCGAGGCTGCCATTGAAAATACAAGCCGGTTGGTCTTGCCGG
TCAAGCGCAGACGGGAGGCAACAGGAAAAGCATCACGAGATGGCGAACAAGGCAATGCAACCTCGCCAATGACAG
AACCCCCTTCGAAGGCACAGAGTCCGACACAGACGCACGGAGATGGACGACCAGGTCATGCCGAAGACATGACAG
CAGCAACAACAGCAGGTAGCACGGGACCGCCTAGCAGACAGACTAGTCTAAATCTGGTGGATCAGAAAACCATGT
CTGACAGGCCATACTTTCAACCAGTCTATAAGAATTCTTCTGCAAACGAAAAATGGCCCTCGTTGATGGGTTCGG
AGGAGCCTTTGAACGTGGAGCAAATGCCAGGACATCTCGAGCATAAAAGTCTCGCAATGTCGCTGGCGGGTATCG
GTGCGGCACACATGGGCTTCAACGATGAGCCAATGCGTGAAATGGCCTTTAGCATGGATGATGAATTTGAAACGA
TTGGGAGACCCAGTCCCATGATGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail