Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1181
Gene name
LocationContig_129:53614..55000
Strand-
Gene length (bp)1386
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 1.0E-15 12 234
PF02803 Thiolase_C Thiolase, C-terminal domain 1.8E-13 277 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 9 398 2.0E-146
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 12 399 9.0E-145
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 12 399 7.0E-143
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 12 399 8.0E-140
sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 12 399 3.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 9 398 2.0E-146
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 12 399 9.0E-145
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 12 399 7.0E-143
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 12 399 8.0E-140
sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 12 399 3.0E-138
sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 9 399 6.0E-137
sp|G5EDP2|NLTP2_CAEEL Non-specific lipid-transfer protein-like 2 OS=Caenorhabditis elegans GN=daf-22 PE=1 SV=1 12 399 8.0E-123
sp|O26884|Y793_METTH Uncharacterized protein MTH_793 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_793 PE=4 SV=1 12 400 4.0E-50
sp|Q58944|Y1549_METJA Uncharacterized protein MJ1549 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1549 PE=4 SV=1 12 368 9.0E-41
sp|P09110|THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens GN=ACAA1 PE=1 SV=2 80 394 2.0E-09
sp|Q43935|CATF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catF PE=3 SV=1 78 356 9.0E-09
sp|Q43974|PCAF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaF PE=1 SV=1 78 356 1.0E-08
sp|Q921H8|THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=1 SV=1 80 394 2.0E-08
sp|Q18AR0|THLA_PEPD6 Acetyl-CoA acetyltransferase OS=Peptoclostridium difficile (strain 630) GN=thlA PE=1 SV=1 28 388 2.0E-08
sp|Q8VCH0|THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=1 SV=1 80 394 4.0E-08
sp|Q3IJ24|FADA_PSEHT 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadA PE=3 SV=1 80 400 5.0E-08
sp|P07871|THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=1 SV=2 80 394 7.0E-08
sp|Q1QUW9|FADA_CHRSD 3-ketoacyl-CoA thiolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fadA PE=3 SV=1 80 368 1.0E-07
sp|A5WH98|FADA_PSYWF 3-ketoacyl-CoA thiolase OS=Psychrobacter sp. (strain PRwf-1) GN=fadA PE=3 SV=1 200 356 2.0E-07
sp|Q9ZCH1|FABH_RICPR 3-oxoacyl-[acyl-carrier-protein] synthase 3 OS=Rickettsia prowazekii (strain Madrid E) GN=fabH PE=3 SV=1 27 133 2.0E-07
sp|P21775|THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus GN=Acaa1a PE=1 SV=2 80 394 2.0E-07
sp|Q21KB1|FADA_SACD2 3-ketoacyl-CoA thiolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=fadA PE=3 SV=1 80 356 3.0E-07
sp|Q1Q8K0|FADA_PSYCK 3-ketoacyl-CoA thiolase OS=Psychrobacter cryohalolentis (strain K5) GN=fadA PE=3 SV=1 85 356 3.0E-07
sp|Q5QXH8|FADA_IDILO 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadA PE=3 SV=1 79 400 1.0E-06
sp|Q0VNZ7|FADA_ALCBS 3-ketoacyl-CoA thiolase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=fadA PE=3 SV=1 85 395 1.0E-06
sp|B0VLX5|FADA_ACIBS 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain SDF) GN=fadA PE=3 SV=1 154 356 2.0E-06
sp|A3M1H9|FADA_ACIBT 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fadA PE=3 SV=2 154 356 2.0E-06
sp|B7H1I1|FADA_ACIB3 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB307-0294) GN=fadA PE=3 SV=1 154 356 2.0E-06
sp|B7I3P0|FADA_ACIB5 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB0057) GN=fadA PE=3 SV=1 154 356 2.0E-06
sp|B2I2J8|FADA_ACIBC 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ACICU) GN=fadA PE=3 SV=1 154 356 2.0E-06
sp|B0VE46|FADA_ACIBY 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AYE) GN=fadA PE=3 SV=1 154 356 2.0E-06
sp|Q4FQC7|FADA_PSYA2 3-ketoacyl-CoA thiolase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadA PE=3 SV=1 162 356 2.0E-06
sp|Q6FF69|FADA_ACIAD 3-ketoacyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadA PE=3 SV=1 154 356 2.0E-06
sp|A0KK76|FADI_AERHH 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadI PE=3 SV=1 214 356 4.0E-06
sp|Q04677|THIB_CANTR Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3 11 356 6.0E-06
sp|Q9KT59|FADI_VIBCH 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadI PE=3 SV=2 214 368 7.0E-06
sp|A5F2P1|FADI_VIBC3 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadI PE=3 SV=2 214 368 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4033
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|650
Ophiocordyceps australis map64 (Brazil) OphauB2|1181 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06751
Ophiocordyceps camponoti-rufipedis Ophun1|593
Ophiocordyceps kimflemingae Ophio5|8070
Ophiocordyceps subramaniannii Hirsu2|8119

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1181
MATKVQGKQSPVYVLGVGMTKFIKPRGSVEYTELGFEAGIKALLDAHINYDDVDQGIACYCYGDSTCGQRVFYQF
GMTKIPVYNVNNNCSTGSTGLAMGRTLIANGAADCVMVVGFEKMKAGSLQSAYNDRESPISTTASMMAETRGFEA
APGAAQMFGNAGREYMEKYGAEADDFAEIARINHAHSPKNPYSQFQQVYSLDEIKQAPSIFQPLTKLQCCPTSDG
GAAAILVSQGFLEARPQLREQAVEIAGQCLATDGPSLFSRSAMDLMGYEMTQYATRTALAQAGVTVDQVQVVELH
DCFSANQMVVLDAMGLSQEGKAHELVRRGDITHGGRYLVNPSGGLISKGHPLGATGIAQCAELVWHLRGWANNRA
KPGTRLCLQHNLGLGGAAVVTVYRRADGREAPLVDSATVGARNGLAYNPAVEAKGFTPEQAQGVRSRTATSDWAL
QDTQDKVTARF*
Coding >OphauB2|1181
ATGGCAACCAAGGTCCAAGGCAAGCAGTCGCCCGTGTACGTGCTGGGGGTGGGCATGACCAAGTTCATCAAGCCG
CGAGGAAGCGTCGAGTACACGGAGCTGGGCTTTGAGGCAGGCATCAAGGCGCTGCTGGATGCGCACATCAACTAC
GACGATGTGGACCAAGGGATTGCCTGCTACTGCTACGGCGACAGCACGTGCGGGCAGCGCGTGTTTTACCAGTTT
GGCATGACCAAGATCCCGGTGTACAACGTCAACAACAACTGCTCGACGGGCAGCACAGGGCTGGCCATGGGGCGG
ACGCTGATTGCAAACGGCGCGGCCGACTGCGTCATGGTGGTTGGGTTTGAGAAGATGAAGGCGGGCAGTCTGCAG
AGCGCCTACAACGACCGCGAGTCGCCCATCAGCACCACGGCATCCATGATGGCAGAGACGCGGGGCTTCGAGGCG
GCGCCGGGGGCGGCGCAAATGTTTGGCAACGCCGGGCGCGAATACATGGAAAAGTATGGAGCCGAGGCGGATGAC
TTTGCCGAGATTGCGCGCATCAACCACGCGCACTCGCCCAAGAACCCCTATTCGCAGTTCCAGCAGGTCTACAGC
CTCGACGAGATCAAGCAGGCGCCCAGCATCTTCCAGCCGCTGACCAAGCTGCAGTGCTGTCCCACGTCGGACGGG
GGCGCCGCGGCCATCTTGGTGTCGCAGGGCTTTTTGGAGGCGCGGCCGCAGCTGCGCGAGCAGGCGGTGGAGATT
GCAGGGCAGTGCCTGGCGACGGACGGGCCCAGCCTCTTTTCGCGCAGCGCCATGGACCTCATGGGCTACGAGATG
ACGCAGTACGCGACGCGGACGGCCCTGGCGCAGGCGGGCGTCACGGTGGACCAGGTGCAGGTGGTGGAGCTTCAC
GACTGCTTCAGCGCCAACCAAATGGTGGTGCTCGACGCCATGGGCCTGAGCCAAGAGGGAAAGGCGCACGAGCTT
GTGCGCCGGGGCGACATTACCCACGGCGGCCGCTATCTCGTCAATCCCTCGGGCGGGCTCATCTCCAAGGGCCAT
CCGCTGGGGGCCACGGGCATCGCACAGTGTGCAGAGCTGGTCTGGCACCTGCGCGGCTGGGCCAACAACCGCGCC
AAGCCCGGCACGCGCCTCTGTCTGCAGCACAATCTGGGCCTGGGCGGAGCTGCCGTTGTCACTGTCTACCGCCGC
GCCGACGGCCGCGAGGCGCCTCTTGTCGACTCGGCCACGGTTGGCGCCCGCAACGGCCTGGCCTACAATCCCGCC
GTCGAGGCCAAGGGCTTCACGCCGGAGCAGGCCCAGGGCGTGCGCAGCCGGACCGCCACCAGCGACTGGGCCCTG
CAGGACACGCAGGACAAGGTTACTGCCCGCTTCTGA
Transcript >OphauB2|1181
ATGGCAACCAAGGTCCAAGGCAAGCAGTCGCCCGTGTACGTGCTGGGGGTGGGCATGACCAAGTTCATCAAGCCG
CGAGGAAGCGTCGAGTACACGGAGCTGGGCTTTGAGGCAGGCATCAAGGCGCTGCTGGATGCGCACATCAACTAC
GACGATGTGGACCAAGGGATTGCCTGCTACTGCTACGGCGACAGCACGTGCGGGCAGCGCGTGTTTTACCAGTTT
GGCATGACCAAGATCCCGGTGTACAACGTCAACAACAACTGCTCGACGGGCAGCACAGGGCTGGCCATGGGGCGG
ACGCTGATTGCAAACGGCGCGGCCGACTGCGTCATGGTGGTTGGGTTTGAGAAGATGAAGGCGGGCAGTCTGCAG
AGCGCCTACAACGACCGCGAGTCGCCCATCAGCACCACGGCATCCATGATGGCAGAGACGCGGGGCTTCGAGGCG
GCGCCGGGGGCGGCGCAAATGTTTGGCAACGCCGGGCGCGAATACATGGAAAAGTATGGAGCCGAGGCGGATGAC
TTTGCCGAGATTGCGCGCATCAACCACGCGCACTCGCCCAAGAACCCCTATTCGCAGTTCCAGCAGGTCTACAGC
CTCGACGAGATCAAGCAGGCGCCCAGCATCTTCCAGCCGCTGACCAAGCTGCAGTGCTGTCCCACGTCGGACGGG
GGCGCCGCGGCCATCTTGGTGTCGCAGGGCTTTTTGGAGGCGCGGCCGCAGCTGCGCGAGCAGGCGGTGGAGATT
GCAGGGCAGTGCCTGGCGACGGACGGGCCCAGCCTCTTTTCGCGCAGCGCCATGGACCTCATGGGCTACGAGATG
ACGCAGTACGCGACGCGGACGGCCCTGGCGCAGGCGGGCGTCACGGTGGACCAGGTGCAGGTGGTGGAGCTTCAC
GACTGCTTCAGCGCCAACCAAATGGTGGTGCTCGACGCCATGGGCCTGAGCCAAGAGGGAAAGGCGCACGAGCTT
GTGCGCCGGGGCGACATTACCCACGGCGGCCGCTATCTCGTCAATCCCTCGGGCGGGCTCATCTCCAAGGGCCAT
CCGCTGGGGGCCACGGGCATCGCACAGTGTGCAGAGCTGGTCTGGCACCTGCGCGGCTGGGCCAACAACCGCGCC
AAGCCCGGCACGCGCCTCTGTCTGCAGCACAATCTGGGCCTGGGCGGAGCTGCCGTTGTCACTGTCTACCGCCGC
GCCGACGGCCGCGAGGCGCCTCTTGTCGACTCGGCCACGGTTGGCGCCCGCAACGGCCTGGCCTACAATCCCGCC
GTCGAGGCCAAGGGCTTCACGCCGGAGCAGGCCCAGGGCGTGCGCAGCCGGACCGCCACCAGCGACTGGGCCCTG
CAGGACACGCAGGACAAGGTTACTGCCCGCTTCTGA
Gene >OphauB2|1181
ATGGCAACCAAGGTCCAAGGCAAGCAGTCGCCCGTGTACGTGCTGGGGGTGGGCATGACCAAGTTCATCAAGCCG
CGAGGAAGCGTCGAGTACACGGAGCTGGGCTTTGAGGCAGGCATCAAGGCGCTGCTGGATGCGCACATCAACTAC
GACGATGTGGACCAAGGGATTGCCTGCTACTGCTACGGCGACAGCACGTGCGGGCAGCGCGTGTTTTACCAGTTT
GGCATGACCAAGATCCCGGTGTACAACGTCAACAACAACTGCTCGACGGGCAGCACAGGGCTGGCCATGGGGCGG
ACGCTGATTGCAAACGGCGCGGCCGACTGCGTCATGGTGGTTGGGTTTGAGAAGATGAAGGCGGGCAGTCTGCAG
AGCGCCTACAACGACCGCGAGTCGCCCATCAGCACCACGGCATCCATGATGGCAGAGACGCGGGGCTTCGAGGCG
GCGCCGGGGGCGGCGCAAATGTTTGGCAACGCCGGGCGCGAATACATGGAAAAGTATGGAGCCGAGGCGGATGAC
TTTGCCGAGATTGCGCGCATCAACCACGCGCACTCGCCCAAGAACCCCTATTCGCAGTTCCAGCAGGTCTACAGC
CTCGACGAGATCAAGCAGGCGCCCAGCATCTTCCAGCCGCTGACCAAGCTGCAGTGCTGTCCCACGTCGGACGGG
GGCGCCGCGGCCATCTTGGTGTCGCAGGGCTTTTTGGAGGCGCGGCCGCAGCTGCGCGAGCAGGCGGTGGAGATT
GCAGGGCAGTGCCTGGCGACGGACGGGCCCAGCCTCTTTTCGCGCAGCGCCATGGACCTCATGGGCTACGAGATG
ACGCAGTACGCGACGCGGACGGCCCTGGCGCAGGCGGGCGTCACGGTGGACCAGGTGCAGGTGGTGGAGCTTCAC
GACTGCTTCAGCGCCAACCAAATGGTGGTGCTCGACGCCATGGGCCTGAGCCAAGAGGGAAAGGCGCACGAGCTT
GTGCGCCGGGGCGACATTACCCACGGCGGCCGCTATCTCGTCAATCCCTCGGGCGGGCTCATCTCCAAGGGCCAT
CCGCTGGGGGCCACGGGCATCGCACAGTGTGCAGAGCTGGTCTGGCACCTGCGCGGCTGGGCCAACAACCGCGCC
AAGCCCGGCACGCGCCTCTGTCTGCAGCACAATCTGGGCCTGGGCGGAGCTGCCGTTGTCACTGTCTACCGCCGC
GCCGACGGCCGCGAGGCGCCTCTTGTCGACTCGGCCACGGTTGGCGCCCGCAACGGCCTGGCCTACAATCCCGCC
GTCGAGGCCAAGGGCTTCACGCCGGAGCAGGCCCAGGGCGTGCGCAGCCGGACCGCCACCAGCGACTGGGCCCTG
CAGGACACGCAGGACAAGGTTACTGCCCGCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail