Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1173
Gene name
LocationContig_129:33249..36937
Strand+
Gene length (bp)3688
Transcript length (bp)3441
Coding sequence length (bp)3441
Protein length (aa) 1147

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 1.3E-06 348 559

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 330 631 2.0E-17
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 329 624 4.0E-14
sp|P34586|TRPL_CAEEL Transient-receptor-potential-like protein OS=Caenorhabditis elegans GN=trp-1 PE=2 SV=3 235 567 1.0E-11

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0005216 ion channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015267 channel activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 338 356 18
2 363 385 22
3 400 422 22
4 435 457 22
5 467 489 22
6 501 520 19
7 530 552 22
8 581 598 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1173
MFSSLLRRSTSGSRRVSRRDQSPHGPRQRLATADFSHVDDFDDDDDDDDGDDNADQDDDQDANEANAQRPHDDED
GSRKTPALLPLFSATHLDALPIYTMTHAIRIIVSTRTETSLTWEQLRSPQVSQFLIKPMQQQIRTLHFSRATLYA
LMANCLQFTKEGQRYAANAGTCSTRAKVCQLLALKLLKEYTTRELIDALAYDFYPLQGIPGADSPLLTGAGLSKA
RMAMTASRTSTLEVAIRASAKHFLAHPVVVQQLEAIWNGAITFYSSADCLHRQSFAASNTRPKLNSATPLLASLP
PKPDSCHPPPGTRTVMLYDPRQASLLKLSRLRVPRYRFFLSTLSLAVLIGLFLAVLSQRSVQITGLELIFWFWSA
GFMLDELVGFNEQGFALYIMSFWNIFDLGILVLLIAYYCMRAYGVFVVDPHHWNAMAYDVLAANAILLLPRIFSV
LDHYQYFSQLLIAFRLMAVDLAAVFVLVLIMCSGFYVFFTLSESANNGDDVAYKIFQILMGFTPAAWDVWPQYNW
LARLLMMMFLIICHFLIVTILITVLTNSFMTIASNATEEHQFVFAINTISMVKNDALFSYIAPSNIFAWLLMPLR
YCMPLKHFVWLNRTIIKVTHFPVLFSICLYERFWLAPSMYEPTDLIENGGRLRRPKSVSFRDPSDRAAMFSPNVR
VREESVVGLHKDRALEEVFRRVPEATTLRTHRRNERRKTQKAIRNWMDQNDEVGVPLTHWPTLDSRAVPEWQRRL
SAAWERSSYPRQVSDLRSTASDPADFASTHGASFSKRPGPRVHESRAEQTDADGDDELVTNDDDEDDIGSNGGES
NQYERHGVEDDDYFTTPVVSHLAKRMEPSRFHGTRQPVARKQNGHGRTLSTSTILYKPDEVARQNSSESSKAYAQ
AATEAWKNGLDEHNGANFPNQTARAGSPQGPMSTSRPALAPRPMAVPRGLAETGGVSRTAMLSLDPRDRLRSGRR
LSSVDMSILSDNMGAEDQNTGLAGSFQTQMAMAMMKDNRLRVAGGMDVADRDRMGRLILARMKTLEESFAEVISE
MRQVKRGSTTLHSSPDSPVDNVARGTTDGSSGGHEFARKAKSQGTAWKEAARRGGSRRDRKQAKADMSDEAEDKN
PSQVKDSQTRPVPRSSADLEA*
Coding >OphauB2|1173
ATGTTTTCCTCGCTGCTGCGCCGCTCCACCAGTGGCTCTCGTCGCGTGTCGAGACGCGACCAGAGTCCACATGGT
CCACGCCAGCGTCTGGCAACGGCCGACTTTAGCCATGTTGATGATTTCGACGACGACGACGACGACGACGACGGC
GACGACAATGCAGACCAAGACGACGACCAAGACGCCAACGAGGCCAATGCACAAAGACCTCATGACGACGAAGAT
GGCAGCCGCAAGACGCCAGCTCTGCTCCCCCTATTTTCCGCCACGCATCTTGATGCACTGCCAATATATACCATG
ACGCACGCCATTCGCATCATTGTTTCGACGCGCACAGAAACGAGCCTGACATGGGAACAGCTGCGCTCTCCCCAG
GTCTCCCAGTTCCTCATCAAGCCAATGCAACAACAGATTCGCACACTGCACTTCTCGCGCGCCACTCTATACGCC
CTCATGGCCAACTGTCTTCAGTTCACCAAAGAGGGCCAAAGGTATGCGGCCAACGCGGGAACATGCAGCACCCGG
GCAAAAGTCTGCCAGCTGCTGGCTCTCAAACTTCTCAAGGAGTATACGACGCGCGAGCTCATTGATGCTTTGGCC
TACGACTTTTATCCGCTTCAAGGCATTCCAGGCGCTGATTCGCCGCTACTGACGGGTGCCGGCCTCAGCAAGGCG
AGGATGGCCATGACGGCTTCCCGAACATCGACTCTCGAGGTGGCCATTCGCGCCTCGGCCAAGCATTTCCTAGCC
CATCCAGTCGTCGTTCAACAGCTCGAGGCCATCTGGAATGGCGCCATCACTTTTTACTCGTCTGCAGACTGTCTG
CATCGCCAGTCTTTCGCCGCCTCAAACACCCGCCCCAAGCTAAACTCGGCCACACCTCTGCTTGCTTCACTCCCG
CCCAAGCCCGACTCTTGCCATCCACCACCGGGGACAAGGACAGTGATGCTATACGACCCACGCCAGGCCTCTTTG
CTGAAGCTGTCTCGTCTACGAGTGCCTCGTTATCGGTTTTTTCTCTCCACCCTCTCTCTTGCTGTTCTCATTGGC
CTCTTCCTAGCCGTCCTGTCCCAGAGGTCTGTGCAAATCACCGGCCTCGAGCTCATCTTTTGGTTCTGGAGCGCA
GGCTTCATGCTTGATGAGCTTGTCGGCTTCAATGAGCAAGGCTTTGCCCTCTACATCATGAGTTTTTGGAACATT
TTTGACCTGGGCATCCTGGTACTACTTATAGCATATTACTGTATGCGCGCCTATGGCGTCTTCGTTGTCGACCCG
CATCATTGGAACGCCATGGCCTACGATGTGCTTGCCGCCAACGCCATTCTTCTCTTGCCGCGCATCTTCAGTGTT
CTTGACCACTACCAATACTTTTCTCAGCTGCTCATTGCCTTTCGCCTCATGGCTGTCGATCTTGCAGCTGTCTTT
GTCCTCGTTCTCATCATGTGCAGTGGTTTTTACGTCTTCTTTACTCTTTCTGAAAGTGCAAACAATGGCGACGAT
GTCGCATACAAGATTTTTCAGATTCTCATGGGCTTCACCCCGGCGGCTTGGGATGTTTGGCCTCAATATAACTGG
CTCGCTCGTCTGCTCATGATGATGTTCCTTATTATTTGCCATTTCTTGATTGTCACTATACTCATCACCGTTTTG
ACAAACTCATTCATGACAATTGCGTCCAACGCAACAGAGGAGCATCAATTTGTTTTTGCCATCAATACCATCTCC
ATGGTGAAGAATGATGCGCTGTTCTCTTATATAGCGCCTAGCAACATATTTGCTTGGCTTCTCATGCCTTTGCGC
TACTGCATGCCACTCAAACACTTTGTTTGGCTCAATCGAACCATTATCAAAGTGACTCATTTTCCAGTCTTGTTT
AGCATCTGTCTATACGAGCGCTTCTGGCTGGCGCCGTCCATGTACGAGCCGACGGACCTGATTGAAAATGGCGGC
AGGCTTCGTCGCCCCAAGTCGGTCTCTTTTAGAGACCCTTCGGATCGAGCGGCAATGTTCAGCCCCAACGTGCGT
GTTCGCGAGGAGTCTGTGGTTGGCTTACATAAAGATCGAGCATTGGAAGAGGTTTTTAGACGCGTGCCCGAGGCC
ACGACACTAAGGACTCACCGGAGGAACGAAAGACGCAAAACGCAAAAGGCAATCCGCAACTGGATGGATCAAAAC
GACGAAGTTGGAGTGCCGCTGACGCACTGGCCCACTTTGGACAGCCGGGCCGTGCCTGAATGGCAGAGGCGTCTG
AGTGCGGCTTGGGAGCGCTCTTCTTACCCAAGACAGGTTTCGGATCTCAGATCAACAGCCAGTGATCCGGCCGAC
TTTGCCTCTACCCACGGGGCATCGTTTTCGAAACGACCTGGGCCGAGGGTGCACGAGTCCAGGGCCGAGCAAACG
GATGCTGATGGCGATGATGAGCTCGTCACCAATGACGATGATGAAGACGACATTGGGTCCAATGGTGGCGAGAGC
AATCAGTATGAGAGACATGGCGTTGAGGATGACGACTACTTTACTACGCCCGTGGTATCACACTTGGCAAAGCGT
ATGGAACCGTCTCGATTCCACGGTACCCGACAGCCCGTGGCGCGCAAGCAAAATGGACATGGCCGGACGCTTTCC
ACAAGCACTATTCTCTATAAACCAGATGAAGTTGCACGTCAGAACAGCTCTGAGTCGTCGAAAGCTTATGCGCAA
GCAGCCACTGAGGCCTGGAAGAATGGACTTGACGAGCACAATGGTGCCAATTTTCCTAACCAAACAGCAAGGGCA
GGTTCTCCACAAGGACCCATGAGTACATCCCGGCCAGCTTTGGCTCCTAGACCAATGGCGGTGCCTCGTGGACTC
GCCGAGACGGGCGGTGTCAGTAGGACAGCTATGCTTAGCCTTGATCCTCGAGACAGGCTTCGGTCGGGCAGAAGG
CTCTCTTCGGTTGACATGAGCATCTTGTCAGACAACATGGGGGCCGAGGATCAAAACACAGGCCTAGCTGGCAGC
TTCCAGACGCAAATGGCCATGGCGATGATGAAGGATAATCGTCTGCGGGTAGCCGGGGGCATGGATGTGGCTGAC
CGAGACAGAATGGGCCGGCTGATTCTGGCACGAATGAAGACGTTGGAAGAGAGCTTTGCCGAGGTGATAAGCGAG
ATGAGACAAGTCAAAAGAGGCTCGACGACGTTGCACTCGAGCCCAGACTCGCCTGTTGACAATGTTGCAAGAGGG
ACAACGGACGGCAGCAGTGGGGGCCACGAATTTGCCCGCAAAGCAAAAAGTCAAGGCACAGCATGGAAAGAGGCT
GCGAGAAGAGGAGGCAGTCGTCGAGATAGAAAGCAAGCCAAGGCGGATATGAGCGACGAGGCTGAAGACAAGAAC
CCAAGCCAAGTCAAAGACAGCCAGACGCGGCCAGTGCCAAGGTCCAGTGCTGACTTGGAAGCTTGA
Transcript >OphauB2|1173
ATGTTTTCCTCGCTGCTGCGCCGCTCCACCAGTGGCTCTCGTCGCGTGTCGAGACGCGACCAGAGTCCACATGGT
CCACGCCAGCGTCTGGCAACGGCCGACTTTAGCCATGTTGATGATTTCGACGACGACGACGACGACGACGACGGC
GACGACAATGCAGACCAAGACGACGACCAAGACGCCAACGAGGCCAATGCACAAAGACCTCATGACGACGAAGAT
GGCAGCCGCAAGACGCCAGCTCTGCTCCCCCTATTTTCCGCCACGCATCTTGATGCACTGCCAATATATACCATG
ACGCACGCCATTCGCATCATTGTTTCGACGCGCACAGAAACGAGCCTGACATGGGAACAGCTGCGCTCTCCCCAG
GTCTCCCAGTTCCTCATCAAGCCAATGCAACAACAGATTCGCACACTGCACTTCTCGCGCGCCACTCTATACGCC
CTCATGGCCAACTGTCTTCAGTTCACCAAAGAGGGCCAAAGGTATGCGGCCAACGCGGGAACATGCAGCACCCGG
GCAAAAGTCTGCCAGCTGCTGGCTCTCAAACTTCTCAAGGAGTATACGACGCGCGAGCTCATTGATGCTTTGGCC
TACGACTTTTATCCGCTTCAAGGCATTCCAGGCGCTGATTCGCCGCTACTGACGGGTGCCGGCCTCAGCAAGGCG
AGGATGGCCATGACGGCTTCCCGAACATCGACTCTCGAGGTGGCCATTCGCGCCTCGGCCAAGCATTTCCTAGCC
CATCCAGTCGTCGTTCAACAGCTCGAGGCCATCTGGAATGGCGCCATCACTTTTTACTCGTCTGCAGACTGTCTG
CATCGCCAGTCTTTCGCCGCCTCAAACACCCGCCCCAAGCTAAACTCGGCCACACCTCTGCTTGCTTCACTCCCG
CCCAAGCCCGACTCTTGCCATCCACCACCGGGGACAAGGACAGTGATGCTATACGACCCACGCCAGGCCTCTTTG
CTGAAGCTGTCTCGTCTACGAGTGCCTCGTTATCGGTTTTTTCTCTCCACCCTCTCTCTTGCTGTTCTCATTGGC
CTCTTCCTAGCCGTCCTGTCCCAGAGGTCTGTGCAAATCACCGGCCTCGAGCTCATCTTTTGGTTCTGGAGCGCA
GGCTTCATGCTTGATGAGCTTGTCGGCTTCAATGAGCAAGGCTTTGCCCTCTACATCATGAGTTTTTGGAACATT
TTTGACCTGGGCATCCTGGTACTACTTATAGCATATTACTGTATGCGCGCCTATGGCGTCTTCGTTGTCGACCCG
CATCATTGGAACGCCATGGCCTACGATGTGCTTGCCGCCAACGCCATTCTTCTCTTGCCGCGCATCTTCAGTGTT
CTTGACCACTACCAATACTTTTCTCAGCTGCTCATTGCCTTTCGCCTCATGGCTGTCGATCTTGCAGCTGTCTTT
GTCCTCGTTCTCATCATGTGCAGTGGTTTTTACGTCTTCTTTACTCTTTCTGAAAGTGCAAACAATGGCGACGAT
GTCGCATACAAGATTTTTCAGATTCTCATGGGCTTCACCCCGGCGGCTTGGGATGTTTGGCCTCAATATAACTGG
CTCGCTCGTCTGCTCATGATGATGTTCCTTATTATTTGCCATTTCTTGATTGTCACTATACTCATCACCGTTTTG
ACAAACTCATTCATGACAATTGCGTCCAACGCAACAGAGGAGCATCAATTTGTTTTTGCCATCAATACCATCTCC
ATGGTGAAGAATGATGCGCTGTTCTCTTATATAGCGCCTAGCAACATATTTGCTTGGCTTCTCATGCCTTTGCGC
TACTGCATGCCACTCAAACACTTTGTTTGGCTCAATCGAACCATTATCAAAGTGACTCATTTTCCAGTCTTGTTT
AGCATCTGTCTATACGAGCGCTTCTGGCTGGCGCCGTCCATGTACGAGCCGACGGACCTGATTGAAAATGGCGGC
AGGCTTCGTCGCCCCAAGTCGGTCTCTTTTAGAGACCCTTCGGATCGAGCGGCAATGTTCAGCCCCAACGTGCGT
GTTCGCGAGGAGTCTGTGGTTGGCTTACATAAAGATCGAGCATTGGAAGAGGTTTTTAGACGCGTGCCCGAGGCC
ACGACACTAAGGACTCACCGGAGGAACGAAAGACGCAAAACGCAAAAGGCAATCCGCAACTGGATGGATCAAAAC
GACGAAGTTGGAGTGCCGCTGACGCACTGGCCCACTTTGGACAGCCGGGCCGTGCCTGAATGGCAGAGGCGTCTG
AGTGCGGCTTGGGAGCGCTCTTCTTACCCAAGACAGGTTTCGGATCTCAGATCAACAGCCAGTGATCCGGCCGAC
TTTGCCTCTACCCACGGGGCATCGTTTTCGAAACGACCTGGGCCGAGGGTGCACGAGTCCAGGGCCGAGCAAACG
GATGCTGATGGCGATGATGAGCTCGTCACCAATGACGATGATGAAGACGACATTGGGTCCAATGGTGGCGAGAGC
AATCAGTATGAGAGACATGGCGTTGAGGATGACGACTACTTTACTACGCCCGTGGTATCACACTTGGCAAAGCGT
ATGGAACCGTCTCGATTCCACGGTACCCGACAGCCCGTGGCGCGCAAGCAAAATGGACATGGCCGGACGCTTTCC
ACAAGCACTATTCTCTATAAACCAGATGAAGTTGCACGTCAGAACAGCTCTGAGTCGTCGAAAGCTTATGCGCAA
GCAGCCACTGAGGCCTGGAAGAATGGACTTGACGAGCACAATGGTGCCAATTTTCCTAACCAAACAGCAAGGGCA
GGTTCTCCACAAGGACCCATGAGTACATCCCGGCCAGCTTTGGCTCCTAGACCAATGGCGGTGCCTCGTGGACTC
GCCGAGACGGGCGGTGTCAGTAGGACAGCTATGCTTAGCCTTGATCCTCGAGACAGGCTTCGGTCGGGCAGAAGG
CTCTCTTCGGTTGACATGAGCATCTTGTCAGACAACATGGGGGCCGAGGATCAAAACACAGGCCTAGCTGGCAGC
TTCCAGACGCAAATGGCCATGGCGATGATGAAGGATAATCGTCTGCGGGTAGCCGGGGGCATGGATGTGGCTGAC
CGAGACAGAATGGGCCGGCTGATTCTGGCACGAATGAAGACGTTGGAAGAGAGCTTTGCCGAGGTGATAAGCGAG
ATGAGACAAGTCAAAAGAGGCTCGACGACGTTGCACTCGAGCCCAGACTCGCCTGTTGACAATGTTGCAAGAGGG
ACAACGGACGGCAGCAGTGGGGGCCACGAATTTGCCCGCAAAGCAAAAAGTCAAGGCACAGCATGGAAAGAGGCT
GCGAGAAGAGGAGGCAGTCGTCGAGATAGAAAGCAAGCCAAGGCGGATATGAGCGACGAGGCTGAAGACAAGAAC
CCAAGCCAAGTCAAAGACAGCCAGACGCGGCCAGTGCCAAGGTCCAGTGCTGACTTGGAAGCTTGA
Gene >OphauB2|1173
ATGTTTTCCTCGCTGCTGCGCCGCTCCACCAGTGGCTCTCGTCGCGTGTCGAGACGCGACCAGAGTCCACATGGT
CCACGCCAGCGTCTGGCAACGGCCGACTTTAGCCATGTTGATGATTTCGACGACGACGACGACGACGACGACGGC
GACGACAATGCAGACCAAGACGACGACCAAGACGCCAACGAGGCCAATGCACAAAGACCTCATGACGACGAAGAT
GGCAGCCGCAAGACGCCAGCTCTGCTCCCCCTATTTTCCGCCACGCATCTTGGTATCTCCCCCATTCCGCATTCC
TCGATGCTCAGGCTGACTCGTCTCGCAGATGCACTGCCAATATATACCATGACGCACGCCATTCGCATCATTGTT
TCGACGCGCACAGAAACGAGCCTGACATGGGAACAGCTGCGCTCTCCCCAGGTCTCCCAGTTCCTCATCAAGCCA
ATGCAACAACAGATTCGCACACTGCACTTCTCGCGCGCCACTCTATACGCCCTCATGGCCAACTGTCTTCAGTTC
ACCAAAGAGGGCCAAAGGTATGCGGCCAACGCGGGAACATGCAGCACCCGGGCAAAAGTCTGCCAGCTGCTGGCT
CTCAAACTTCTCAAGGAGTATACGACGCGCGAGCTCATTGATGCTTTGGCCTACGACTTTTATCCGCTTCAAGGC
ATTCCAGGCGCTGATTCGCCGCTACTGACGGGTGCCGGCCTCAGCAAGGCGAGGATGGCCATGACGGCTTCCCGA
ACATCGACTCTCGAGGTGGCCATTCGCGCCTCGGCCAAGCATTTCCTAGCCCATCCAGTCGTCGTTCAACAGCTC
GAGGCCATCTGGAATGGCGCCATCACTTTTTACTCGTCTGCAGACTGTCTGCATCGCCAGTCTTTCGCCGCCTCA
AACACCCGCCCCAAGCTAAACTCGGCCACACCTCTGCTTGCTTCACTCCCGCCCAAGCCCGACTCTTGCCATCCA
CCACCGGGGACAAGGACAGTGATGCTATACGACCCACGCCAGGCCTCTTTGCTGAAGCTGTCTCGTCTACGAGTG
CCTCGTTATCGGTTTTTTCTCTCCACCCTCTCTCTTGCTGTTCTCATTGGCCTCTTCCTAGCCGTCCTGTCCCAG
AGGTCTGTGCAAATCACCGGCCTCGAGCTCATCTTTTGGTTCTGGAGCGCAGGCTTCATGCTTGATGAGCTTGTC
GGCTTCAATGAGCAAGGCTTTGCCCTCTACATCATGAGTTTTTGGAACATTTTTGACCTGGGCATCCTGGTACTA
CTTATAGCATATTACTGTATGCGCGCCTATGGCGTCTTCGTTGTCGACCCGCATCATTGGAACGCCATGGCCTAC
GATGTGCTTGCCGCCAACGCCATTCTTCTCTTGCCGCGCATCTTCAGTGTTCTTGACCACTACCAATACTTTTCT
CAGCTGCTCATTGCCTTTCGCCTCATGGCTGTCGATCTTGCAGCTGTCTTTGTCCTCGTTCTCATCATGTGCAGT
GGTTTTTACGTCTTCTTTACTCTTTCTGAAAGTGCAAACAATGGCGACGATGTCGCATACAAGATTTTTCAGATT
CTCATGGGCTTCACCCCGGCGGCTTGGGATGTGTCTGTATACCCCTAGTCTCTACTCATGTAAATGGCCATGCGC
TAACCTACATTACAGTTGGCCTCAATATAACTGGCTCGCTCGTCTGCTCATGATGATGTTCCTTATTATTTGCCA
TTTCTTGATTGTGTTGGTCTCCCAGCCTGCTTTATCTTGGATTTGAGCTTTTGCTAATTTGTGTCCTGGGCAACT
AAGCACTATACTCATCACCGTTTTGACAAACTCATTCATGACAATTGCGTCCAACGCAACAGAGGAGCATCAGTA
CGTTCAACGTGGAGCCATGGCCAAGGAAAGCAAGCACCGCAAGACAAATAAAGCTCACACTTGGCACAGATTTGT
TTTTGCCATCAATACCATCTCCATGGTGAAGAATGATGCGCTGTTCTCTTATATAGCGCCTAGCAACATATTTGC
TTGGCTTCTCATGCCTTTGCGCTACTGCATGCCACTCAAACACTTTGTTTGGCTCAATCGAACCATTATCAAAGT
GACTCATTTTCCAGTCTTGTTTAGCATCTGTCTATACGAGCGCTTCTGGCTGGCGCCGTCCATGTACGAGCCGAC
GGACCTGATTGAAAATGGCGGCAGGCTTCGTCGCCCCAAGTCGGTCTCTTTTAGAGACCCTTCGGATCGAGCGGC
AATGTTCAGCCCCAACGTGCGTGTTCGCGAGGAGTCTGTGGTTGGCTTACATAAAGATCGAGCATTGGAAGAGGT
TTTTAGACGCGTGCCCGAGGCCACGACACTAAGGACTCACCGGAGGAACGAAAGACGCAAAACGCAAAAGGCAAT
CCGCAACTGGATGGATCAAAACGACGAAGTTGGAGTGCCGCTGACGCACTGGCCCACTTTGGACAGCCGGGCCGT
GCCTGAATGGCAGAGGCGTCTGAGTGCGGCTTGGGAGCGCTCTTCTTACCCAAGACAGGTTTCGGATCTCAGATC
AACAGCCAGTGATCCGGCCGACTTTGCCTCTACCCACGGGGCATCGTTTTCGAAACGACCTGGGCCGAGGGTGCA
CGAGTCCAGGGCCGAGCAAACGGATGCTGATGGCGATGATGAGCTCGTCACCAATGACGATGATGAAGACGACAT
TGGGTCCAATGGTGGCGAGAGCAATCAGTATGAGAGACATGGCGTTGAGGATGACGACTACTTTACTACGCCCGT
GGTATCACACTTGGCAAAGCGTATGGAACCGTCTCGATTCCACGGTACCCGACAGCCCGTGGCGCGCAAGCAAAA
TGGACATGGCCGGACGCTTTCCACAAGCACTATTCTCTATAAACCAGATGAAGTTGCACGTCAGAACAGCTCTGA
GTCGTCGAAAGCTTATGCGCAAGCAGCCACTGAGGCCTGGAAGAATGGACTTGACGAGCACAATGGTGCCAATTT
TCCTAACCAAACAGCAAGGGCAGGTTCTCCACAAGGACCCATGAGTACATCCCGGCCAGCTTTGGCTCCTAGACC
AATGGCGGTGCCTCGTGGACTCGCCGAGACGGGCGGTGTCAGTAGGACAGCTATGCTTAGCCTTGATCCTCGAGA
CAGGCTTCGGTCGGGCAGAAGGCTCTCTTCGGTTGACATGAGCATCTTGTCAGACAACATGGGGGCCGAGGATCA
AAACACAGGCCTAGCTGGCAGCTTCCAGACGCAAATGGCCATGGCGATGATGAAGGATAATCGTCTGCGGGTAGC
CGGGGGCATGGATGTGGCTGACCGAGACAGAATGGGCCGGCTGATTCTGGCACGAATGAAGACGTTGGAAGAGAG
CTTTGCCGAGGTGATAAGCGAGATGAGACAAGTCAAAAGAGGCTCGACGACGTTGCACTCGAGCCCAGACTCGCC
TGTTGACAATGTTGCAAGAGGGACAACGGACGGCAGCAGTGGGGGCCACGAATTTGCCCGCAAAGCAAAAAGTCA
AGGCACAGCATGGAAAGAGGCTGCGAGAAGAGGAGGCAGTCGTCGAGATAGAAAGCAAGCCAAGGCGGATATGAG
CGACGAGGCTGAAGACAAGAACCCAAGCCAAGTCAAAGACAGCCAGACGCGGCCAGTGCCAAGGTCCAGTGCTGA
CTTGGAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail