Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1172
Gene name
LocationContig_129:29109..32037
Strand-
Gene length (bp)2928
Transcript length (bp)2811
Coding sequence length (bp)2811
Protein length (aa) 937

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.3E-44 220 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 189 420 9.0E-52
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 189 430 2.0E-49
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 190 473 1.0E-47
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 205 432 2.0E-46
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 190 432 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 189 420 9.0E-52
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 189 430 2.0E-49
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 190 473 1.0E-47
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 205 432 2.0E-46
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 190 432 3.0E-46
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 205 432 4.0E-46
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 187 432 4.0E-46
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 187 432 5.0E-46
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 187 432 5.0E-46
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 186 441 8.0E-44
sp|A6H6A9|RBG1L_MOUSE Rab GTPase-activating protein 1-like OS=Mus musculus GN=Rabgap1l PE=1 SV=1 205 432 1.0E-43
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 185 441 5.0E-42
sp|P97366|EVI5_MOUSE Ecotropic viral integration site 5 protein OS=Mus musculus GN=Evi5 PE=1 SV=2 189 430 4.0E-40
sp|Q8BYJ6|TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus GN=Tbc1d4 PE=1 SV=2 208 434 8.0E-33
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 212 432 9.0E-31
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 190 413 4.0E-30
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 211 469 9.0E-30
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 190 413 1.0E-29
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 211 469 1.0E-29
sp|Q86TI0|TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens GN=TBC1D1 PE=1 SV=2 208 434 1.0E-28
sp|Q60949|TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus GN=Tbc1d1 PE=1 SV=3 212 432 2.0E-28
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 190 434 2.0E-28
sp|O97790|TBCD1_BOVIN TBC1 domain family member 1 OS=Bos taurus GN=TBC1D1 PE=2 SV=2 208 434 4.0E-28
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 190 413 9.0E-28
sp|Q10496|GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp51 PE=3 SV=1 220 450 3.0E-25
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 200 420 8.0E-25
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 198 443 6.0E-24
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 206 424 2.0E-21
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 188 485 2.0E-21
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 182 443 2.0E-21
sp|Q04322|GYL1_YEAST Probable GTPase-activating protein GYL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYL1 PE=1 SV=1 189 441 4.0E-21
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 212 427 4.0E-21
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 208 420 8.0E-21
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 212 432 2.0E-20
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 212 432 5.0E-20
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 212 452 7.0E-20
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 212 451 8.0E-20
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 212 443 1.0E-19
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 211 422 4.0E-19
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 212 427 5.0E-19
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 211 475 6.0E-19
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 197 420 1.0E-18
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 257 427 1.0E-18
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 197 420 2.0E-18
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 208 449 2.0E-18
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 208 432 2.0E-18
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 197 420 4.0E-18
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 212 432 5.0E-18
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 212 432 7.0E-18
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 208 432 7.0E-18
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 212 420 1.0E-17
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 212 432 1.0E-17
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 212 432 2.0E-17
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 197 420 2.0E-17
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 205 421 3.0E-17
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 208 432 4.0E-17
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 207 429 4.0E-17
sp|Q9Y7J5|YOI9_SCHPO TBC domain-containing protein C1778.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.09 PE=3 SV=1 214 446 1.0E-16
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 209 420 1.0E-16
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 212 432 2.0E-16
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 212 432 3.0E-16
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 208 464 4.0E-16
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 212 432 5.0E-16
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 208 431 1.0E-15
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 208 431 3.0E-15
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 209 437 3.0E-15
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 209 437 3.0E-15
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 208 431 5.0E-14
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 214 420 7.0E-14
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 209 413 1.0E-13
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 209 416 8.0E-13
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 209 416 8.0E-13
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 209 416 1.0E-12
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 208 411 1.0E-12
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 214 420 2.0E-12
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 214 420 3.0E-12
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 250 464 1.0E-09
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 200 419 3.0E-09
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 213 421 4.0E-09
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 250 464 9.0E-09
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 213 485 1.0E-08
sp|O96904|TBC12_DICDI Drainin OS=Dictyostelium discoideum GN=phgA PE=1 SV=1 253 413 2.0E-08
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 213 421 7.0E-08
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 237 420 9.0E-08
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 208 328 3.0E-07
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 208 335 6.0E-06
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 208 335 6.0E-06
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 208 335 6.0E-06
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 208 335 6.0E-06
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 208 335 6.0E-06
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 208 335 6.0E-06
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 208 335 7.0E-06
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 208 335 7.0E-06
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 208 335 7.0E-06
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 208 335 8.0E-06
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 208 335 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1172
MAAAGAHETPDQVSNMAHDSLVTVRLSEPSAVMGAHVSEPSQSDGATHDNQRDSSTTLLPDDAPRGLRDQLGEAD
AETDAETHAEAHDSNSCRDADEVNWAQLEKTEGEQVKDDETDNSTALLLARLEQENAKLATNPKSVHVQVVNHNR
ASKPRPPSMAQLRQMVTGPTPPALRYSMLPPPPMTDLEFYAALVKDYQQTAARLPTLLSNKIRKGIPPPLRGVVW
QSMSGARDAALEEQYERFCGESSPYELLIGKDLGRSFPGVDMFREPDGDGQRMLGRVLRSFSLYDTKIGYCQGLG
FLVGPLLMHMPDKQAFCVLVRLMERYDLRSCFLPDLSGLHVRIYQFRELLRLTLPVLSSRLETLQVETAYVSQWF
LSFFAVTCPLPMLFRVYDVIFAEGASETLMRVALSLMRRNEARLLACAEMEDAMQLLLSRGLWDCYHYDADEFVR
DFVSLTAVVTRERLAQLEQDYKESLVAPSNAPRASDITTAATRFLGRIWAPSAGNKSTTLTPGLAGPLRPLSMLR
RSTSKQSLASTLNSIEASVSSSTSTDATGLTRDSASTEECSSTSRDSALAGSKASPTARAADEKYLHTQIEELLT
ALSELQRDHALATKQLEWEREEREEDRKAVRLLLEGLSKTMATEQRLQTDKTVPIMSAESVATPASAGSQDVSEA
MRLVQSRLGDDDEKSKEVGQSRLQLKEELMSVKRQLASAVSQCQELSRRVHDMDHEMMSLKEQLRERQGHMRTLH
QDKQRLEKQISGLRGRASASSGRETTQRDTEGEGASKGGGSGGGGLREFKLGRSKSTPTQATGLERRTSSLPQSQ
DTASGGAATGSKAASSAGEHEALLAELVQAKTAEAMAKQEAEEAKQRLEALRKSCGLGTGDSATTSPPSHIGVGV
LGRLTGHGAADSAVMKPAAVSTTSPFASSSFWGWRR*
Coding >OphauB2|1172
ATGGCGGCCGCCGGTGCCCATGAGACGCCAGACCAAGTCTCAAACATGGCCCACGATTCTCTTGTAACCGTCAGG
CTCTCGGAGCCTTCAGCTGTCATGGGCGCCCACGTGAGCGAGCCGTCTCAATCCGACGGCGCCACGCACGACAAT
CAGCGCGACTCTTCAACTACTCTCTTGCCCGACGATGCCCCCCGCGGCCTGCGAGACCAGCTGGGAGAAGCCGAC
GCTGAGACGGACGCCGAGACGCATGCCGAGGCCCACGACAGCAACTCTTGCCGCGATGCCGACGAGGTCAATTGG
GCTCAGCTGGAAAAGACGGAGGGGGAACAGGTCAAAGACGACGAAACAGACAATTCGACTGCCCTGCTGCTTGCA
CGCCTGGAACAGGAAAATGCAAAACTAGCAACCAACCCAAAGAGCGTTCACGTTCAAGTTGTCAATCACAACCGC
GCAAGCAAGCCTCGTCCGCCCTCCATGGCTCAACTTCGACAGATGGTGACGGGTCCGACGCCGCCTGCCCTGCGC
TACTCCATGCTGCCTCCCCCGCCCATGACGGACCTCGAATTCTACGCTGCCCTTGTCAAGGACTATCAACAGACG
GCCGCTAGACTACCCACTCTGTTGTCCAATAAGATTCGAAAGGGAATTCCGCCTCCACTGAGAGGTGTGGTTTGG
CAGAGCATGTCTGGCGCCCGCGATGCCGCCCTCGAGGAACAATATGAACGTTTCTGTGGCGAGTCTAGTCCCTAT
GAGCTTCTCATTGGAAAAGATCTTGGCAGGAGTTTTCCCGGTGTCGACATGTTTCGCGAGCCCGATGGCGATGGG
CAGCGCATGCTTGGCCGTGTTCTTCGATCTTTCAGTCTTTACGATACAAAAATCGGCTACTGTCAGGGCCTCGGC
TTCCTCGTCGGTCCCTTGCTCATGCATATGCCCGACAAGCAGGCTTTTTGTGTTCTCGTTCGCTTAATGGAGCGC
TATGACCTGCGCTCTTGTTTCCTGCCCGACCTTTCGGGACTTCATGTCCGCATATATCAATTTCGAGAGTTGCTT
CGGCTAACTCTTCCCGTCTTATCAAGTCGCCTAGAGACCTTGCAGGTGGAAACGGCCTATGTATCGCAGTGGTTT
CTCAGCTTCTTCGCTGTTACGTGTCCGCTTCCCATGCTGTTTCGTGTATACGACGTCATCTTTGCCGAAGGTGCT
TCGGAGACACTGATGCGCGTTGCCCTATCACTCATGAGGAGAAATGAGGCGCGGCTGTTGGCCTGCGCTGAGATG
GAAGATGCAATGCAGCTTCTCTTGTCCCGCGGCTTATGGGACTGTTATCACTACGACGCCGACGAATTTGTCCGC
GATTTTGTCAGTCTGACGGCTGTCGTAACTCGAGAAAGACTAGCTCAGCTTGAACAAGACTACAAGGAGTCTCTT
GTAGCTCCCTCCAACGCACCTCGAGCGTCAGACATTACAACAGCGGCGACTCGCTTCCTCGGCCGTATTTGGGCT
CCTTCAGCGGGAAACAAGAGCACCACACTGACTCCCGGTCTCGCGGGACCCTTGCGGCCTCTGAGCATGTTGCGT
CGCAGTACCTCGAAACAGAGCCTTGCTTCGACGCTCAACTCGATTGAAGCCAGCGTGTCAAGTTCCACCTCGACA
GACGCAACAGGCCTGACCCGTGACTCTGCCAGCACCGAGGAGTGCTCCTCTACCAGTCGAGACTCGGCCCTAGCA
GGTTCCAAGGCCTCACCGACTGCAAGAGCTGCAGACGAAAAATATCTACATACGCAGATTGAAGAACTATTGACA
GCGCTGAGCGAGCTACAGCGTGATCATGCTCTGGCGACGAAGCAACTGGAGTGGGAGCGAGAGGAGCGAGAGGAG
GATCGCAAAGCCGTCAGGTTGCTTCTAGAGGGGCTCAGCAAGACAATGGCAACGGAGCAAAGATTGCAGACTGAC
AAGACCGTTCCAATAATGAGTGCCGAGAGCGTGGCCACTCCTGCATCAGCAGGCTCACAAGACGTGTCTGAAGCT
ATGCGGCTTGTGCAATCTCGTCTAGGGGATGACGACGAAAAGTCCAAAGAAGTGGGGCAGTCTAGACTGCAGCTC
AAGGAAGAATTAATGAGCGTCAAGAGGCAACTGGCGAGTGCAGTATCCCAATGCCAGGAACTGAGCCGTCGGGTG
CATGACATGGACCACGAAATGATGTCTCTCAAGGAGCAACTCAGAGAGCGTCAAGGCCATATGCGAACTTTGCAT
CAGGACAAGCAGCGATTGGAGAAGCAGATAAGTGGCTTGCGAGGCCGCGCCTCTGCTAGTAGCGGGCGAGAGACG
ACTCAGCGAGACACAGAAGGCGAAGGGGCCAGCAAGGGGGGCGGGAGTGGCGGCGGGGGCTTGAGAGAATTCAAA
CTCGGACGCAGCAAGTCGACTCCAACTCAGGCTACCGGGCTGGAAAGAAGAACATCGTCACTGCCTCAGTCGCAG
GACACTGCGTCTGGTGGTGCGGCGACGGGGTCCAAGGCTGCATCTTCTGCAGGGGAGCATGAGGCCTTGTTGGCG
GAGCTTGTGCAAGCCAAGACGGCCGAGGCTATGGCTAAGCAGGAAGCCGAAGAAGCAAAGCAGAGATTGGAGGCA
CTGCGTAAGAGCTGTGGCCTGGGCACAGGAGACTCTGCTACAACGTCACCACCCAGTCATATCGGGGTTGGAGTG
CTTGGCCGGCTGACGGGGCACGGGGCAGCTGATTCGGCCGTCATGAAGCCTGCTGCAGTGAGTACGACGTCACCT
TTTGCGAGCAGCAGCTTTTGGGGCTGGCGGAGATGA
Transcript >OphauB2|1172
ATGGCGGCCGCCGGTGCCCATGAGACGCCAGACCAAGTCTCAAACATGGCCCACGATTCTCTTGTAACCGTCAGG
CTCTCGGAGCCTTCAGCTGTCATGGGCGCCCACGTGAGCGAGCCGTCTCAATCCGACGGCGCCACGCACGACAAT
CAGCGCGACTCTTCAACTACTCTCTTGCCCGACGATGCCCCCCGCGGCCTGCGAGACCAGCTGGGAGAAGCCGAC
GCTGAGACGGACGCCGAGACGCATGCCGAGGCCCACGACAGCAACTCTTGCCGCGATGCCGACGAGGTCAATTGG
GCTCAGCTGGAAAAGACGGAGGGGGAACAGGTCAAAGACGACGAAACAGACAATTCGACTGCCCTGCTGCTTGCA
CGCCTGGAACAGGAAAATGCAAAACTAGCAACCAACCCAAAGAGCGTTCACGTTCAAGTTGTCAATCACAACCGC
GCAAGCAAGCCTCGTCCGCCCTCCATGGCTCAACTTCGACAGATGGTGACGGGTCCGACGCCGCCTGCCCTGCGC
TACTCCATGCTGCCTCCCCCGCCCATGACGGACCTCGAATTCTACGCTGCCCTTGTCAAGGACTATCAACAGACG
GCCGCTAGACTACCCACTCTGTTGTCCAATAAGATTCGAAAGGGAATTCCGCCTCCACTGAGAGGTGTGGTTTGG
CAGAGCATGTCTGGCGCCCGCGATGCCGCCCTCGAGGAACAATATGAACGTTTCTGTGGCGAGTCTAGTCCCTAT
GAGCTTCTCATTGGAAAAGATCTTGGCAGGAGTTTTCCCGGTGTCGACATGTTTCGCGAGCCCGATGGCGATGGG
CAGCGCATGCTTGGCCGTGTTCTTCGATCTTTCAGTCTTTACGATACAAAAATCGGCTACTGTCAGGGCCTCGGC
TTCCTCGTCGGTCCCTTGCTCATGCATATGCCCGACAAGCAGGCTTTTTGTGTTCTCGTTCGCTTAATGGAGCGC
TATGACCTGCGCTCTTGTTTCCTGCCCGACCTTTCGGGACTTCATGTCCGCATATATCAATTTCGAGAGTTGCTT
CGGCTAACTCTTCCCGTCTTATCAAGTCGCCTAGAGACCTTGCAGGTGGAAACGGCCTATGTATCGCAGTGGTTT
CTCAGCTTCTTCGCTGTTACGTGTCCGCTTCCCATGCTGTTTCGTGTATACGACGTCATCTTTGCCGAAGGTGCT
TCGGAGACACTGATGCGCGTTGCCCTATCACTCATGAGGAGAAATGAGGCGCGGCTGTTGGCCTGCGCTGAGATG
GAAGATGCAATGCAGCTTCTCTTGTCCCGCGGCTTATGGGACTGTTATCACTACGACGCCGACGAATTTGTCCGC
GATTTTGTCAGTCTGACGGCTGTCGTAACTCGAGAAAGACTAGCTCAGCTTGAACAAGACTACAAGGAGTCTCTT
GTAGCTCCCTCCAACGCACCTCGAGCGTCAGACATTACAACAGCGGCGACTCGCTTCCTCGGCCGTATTTGGGCT
CCTTCAGCGGGAAACAAGAGCACCACACTGACTCCCGGTCTCGCGGGACCCTTGCGGCCTCTGAGCATGTTGCGT
CGCAGTACCTCGAAACAGAGCCTTGCTTCGACGCTCAACTCGATTGAAGCCAGCGTGTCAAGTTCCACCTCGACA
GACGCAACAGGCCTGACCCGTGACTCTGCCAGCACCGAGGAGTGCTCCTCTACCAGTCGAGACTCGGCCCTAGCA
GGTTCCAAGGCCTCACCGACTGCAAGAGCTGCAGACGAAAAATATCTACATACGCAGATTGAAGAACTATTGACA
GCGCTGAGCGAGCTACAGCGTGATCATGCTCTGGCGACGAAGCAACTGGAGTGGGAGCGAGAGGAGCGAGAGGAG
GATCGCAAAGCCGTCAGGTTGCTTCTAGAGGGGCTCAGCAAGACAATGGCAACGGAGCAAAGATTGCAGACTGAC
AAGACCGTTCCAATAATGAGTGCCGAGAGCGTGGCCACTCCTGCATCAGCAGGCTCACAAGACGTGTCTGAAGCT
ATGCGGCTTGTGCAATCTCGTCTAGGGGATGACGACGAAAAGTCCAAAGAAGTGGGGCAGTCTAGACTGCAGCTC
AAGGAAGAATTAATGAGCGTCAAGAGGCAACTGGCGAGTGCAGTATCCCAATGCCAGGAACTGAGCCGTCGGGTG
CATGACATGGACCACGAAATGATGTCTCTCAAGGAGCAACTCAGAGAGCGTCAAGGCCATATGCGAACTTTGCAT
CAGGACAAGCAGCGATTGGAGAAGCAGATAAGTGGCTTGCGAGGCCGCGCCTCTGCTAGTAGCGGGCGAGAGACG
ACTCAGCGAGACACAGAAGGCGAAGGGGCCAGCAAGGGGGGCGGGAGTGGCGGCGGGGGCTTGAGAGAATTCAAA
CTCGGACGCAGCAAGTCGACTCCAACTCAGGCTACCGGGCTGGAAAGAAGAACATCGTCACTGCCTCAGTCGCAG
GACACTGCGTCTGGTGGTGCGGCGACGGGGTCCAAGGCTGCATCTTCTGCAGGGGAGCATGAGGCCTTGTTGGCG
GAGCTTGTGCAAGCCAAGACGGCCGAGGCTATGGCTAAGCAGGAAGCCGAAGAAGCAAAGCAGAGATTGGAGGCA
CTGCGTAAGAGCTGTGGCCTGGGCACAGGAGACTCTGCTACAACGTCACCACCCAGTCATATCGGGGTTGGAGTG
CTTGGCCGGCTGACGGGGCACGGGGCAGCTGATTCGGCCGTCATGAAGCCTGCTGCAGTGAGTACGACGTCACCT
TTTGCGAGCAGCAGCTTTTGGGGCTGGCGGAGATGA
Gene >OphauB2|1172
ATGGCGGCCGCCGGTGCCCATGAGACGCCAGACCAAGTCTCAAACATGGCCCACGATTCTCTTGTAACCGTCAGG
CTCTCGGAGCCTTCAGCTGTCATGGGCGCCCACGTGAGCGAGCCGTCTCAATCCGACGGCGCCACGCACGACAAT
CAGCGCGACTCTTCAACTACTCTCTTGCCCGACGATGCCCCCCGCGGCCTGCGAGACCAGCTGGGAGAAGCCGAC
GCTGAGACGGACGCCGAGACGCATGCCGAGGCCCACGACAGCAACTCTTGCCGCGATGCCGACGAGGTCAATTGG
GCTCAGCTGGAAAAGACGGAGGGGGAACAGGTCAAAGACGACGAAACAGACAATGTAAGTCAAGCACATGGCACC
CCAATCCGCCCGCAGCAGTGCTCACCTGGCCTTGCAACAGTCGACTGCCCTGCTGCTTGCACGCCTGGAACAGGA
AAATGCAAAACTAGCAACCAACCCAAAGAGCGTTCACGTTCAAGTTGTCAATCACAACCGCGCAAGCAAGCCTCG
TCCGCCCTCCATGGCTCAACTTCGACAGATGGTGACGGGTCCGACGCCGCCTGCCCTGCGCTACTCCATGCTGCC
TCCCCCGCCCATGACGGACCTCGAATTCTACGCTGCCCTTGTCAAGGACTATCAACAGACGGCCGCTAGACTACC
CACTCTGTTGTCCAATAAGATTCGAAAGGGAATTCCGCCTCCACTGAGAGGTGTGGTTTGGCAGAGCATGTCTGG
CGCCCGCGATGCCGCCCTCGAGGAACAATATGAACGTTTCTGTGGCGAGTCTAGTCCCTATGAGCTTCTCATTGG
AAAAGATCTTGGCAGGAGTTTTCCCGGTGTCGACATGTTTCGCGAGCCCGATGGCGATGGGCAGCGCATGCTTGG
CCGTGTTCTTCGATCTTTCAGTCTTTACGATACAAAAATCGGCTACTGTCAGGGCCTCGGCTTCCTCGTCGGTCC
CTTGCTCATGCATATGCCCGACAAGCAGGCTTTTTGTGTTCTCGTTCGGTGGGCACGCTCCTTTTCCACCATCCA
GCTCCTTTACTAATTTGCCCTTTTACTAGCTTAATGGAGCGCTATGACCTGCGCTCTTGTTTCCTGCCCGACCTT
TCGGGACTTCATGTCCGCATATATCAATTTCGAGAGTTGCTTCGGCTAACTCTTCCCGTCTTATCAAGTCGCCTA
GAGACCTTGCAGGTGGAAACGGCCTATGTATCGCAGTGGTTTCTCAGCTTCTTCGCTGTTACGTGTCCGCTTCCC
ATGCTGTTTCGTGTATACGACGTCATCTTTGCCGAAGGTGCTTCGGAGACACTGATGCGCGTTGCCCTATCACTC
ATGAGGAGAAATGAGGCGCGGCTGTTGGCCTGCGCTGAGATGGAAGATGCAATGCAGCTTCTCTTGTCCCGCGGC
TTATGGGACTGTTATCACTACGACGCCGACGAATTTGTCCGCGATTTTGTCAGTCTGACGGCTGTCGTAACTCGA
GAAAGACTAGCTCAGCTTGAACAAGACTACAAGGAGTCTCTTGTAGCTCCCTCCAACGCACCTCGAGCGTCAGAC
ATTACAACAGCGGCGACTCGCTTCCTCGGCCGTATTTGGGCTCCTTCAGCGGGAAACAAGAGCACCACACTGACT
CCCGGTCTCGCGGGACCCTTGCGGCCTCTGAGCATGTTGCGTCGCAGTACCTCGAAACAGAGCCTTGCTTCGACG
CTCAACTCGATTGAAGCCAGCGTGTCAAGTTCCACCTCGACAGACGCAACAGGCCTGACCCGTGACTCTGCCAGC
ACCGAGGAGTGCTCCTCTACCAGTCGAGACTCGGCCCTAGCAGGTTCCAAGGCCTCACCGACTGCAAGAGCTGCA
GACGAAAAATATCTACATACGCAGATTGAAGAACTATTGACAGCGCTGAGCGAGCTACAGCGTGATCATGCTCTG
GCGACGAAGCAACTGGAGTGGGAGCGAGAGGAGCGAGAGGAGGATCGCAAAGCCGTCAGGTTGCTTCTAGAGGGG
CTCAGCAAGACAATGGCAACGGAGCAAAGATTGCAGACTGACAAGACCGTTCCAATAATGAGTGCCGAGAGCGTG
GCCACTCCTGCATCAGCAGGCTCACAAGACGTGTCTGAAGCTATGCGGCTTGTGCAATCTCGTCTAGGGGATGAC
GACGAAAAGTCCAAAGAAGTGGGGCAGTCTAGACTGCAGCTCAAGGAAGAATTAATGAGCGTCAAGAGGCAACTG
GCGAGTGCAGTATCCCAATGCCAGGAACTGAGCCGTCGGGTGCATGACATGGACCACGAAATGATGTCTCTCAAG
GAGCAACTCAGAGAGCGTCAAGGCCATATGCGAACTTTGCATCAGGACAAGCAGCGATTGGAGAAGCAGATAAGT
GGCTTGCGAGGCCGCGCCTCTGCTAGTAGCGGGCGAGAGACGACTCAGCGAGACACAGAAGGCGAAGGGGCCAGC
AAGGGGGGCGGGAGTGGCGGCGGGGGCTTGAGAGAATTCAAACTCGGACGCAGCAAGTCGACTCCAACTCAGGCT
ACCGGGCTGGAAAGAAGAACATCGTCACTGCCTCAGTCGCAGGACACTGCGTCTGGTGGTGCGGCGACGGGGTCC
AAGGCTGCATCTTCTGCAGGGGAGCATGAGGCCTTGTTGGCGGAGCTTGTGCAAGCCAAGACGGCCGAGGCTATG
GCTAAGCAGGAAGCCGAAGAAGCAAAGCAGAGATTGGAGGCACTGCGTAAGAGCTGTGGCCTGGGCACAGGAGAC
TCTGCTACAACGTCACCACCCAGTCATATCGGGGTTGGAGTGCTTGGCCGGCTGACGGGGCACGGGGCAGCTGAT
TCGGCCGTCATGAAGCCTGCTGCAGTGAGTACGACGTCACCTTTTGCGAGCAGCAGCTTTTGGGGCTGGCGGAGA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail