Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1165
Gene name
LocationContig_129:10876..12916
Strand-
Gene length (bp)2040
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 1.9E-24 17 179
PF00271 Helicase_C Helicase conserved C-terminal domain 7.8E-13 258 356
PF00270 DEAD DEAD/DEAH box helicase 4.3E-11 21 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 17 592 3.0E-117
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 19 385 9.0E-106
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 17 371 1.0E-28
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 48 369 2.0E-16
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 15 374 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 17 592 3.0E-117
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 19 385 9.0E-106
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 17 371 1.0E-28
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 48 369 2.0E-16
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 15 374 2.0E-16
sp|Q07736|T1RA_ECOLX Type I restriction enzyme EcoAI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 20 454 3.0E-14
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 17 376 5.0E-14
sp|Q47281|T1RE_ECOLX Type I restriction enzyme EcoEI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 20 413 8.0E-13
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 37 335 1.0E-09
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 37 335 6.0E-09
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 74 335 9.0E-08
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 266 355 4.0E-07
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 266 355 4.0E-07
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 266 355 4.0E-07
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 266 355 4.0E-07
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 266 355 4.0E-07
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 266 355 5.0E-07
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 266 355 5.0E-07
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 266 355 5.0E-07
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 266 355 6.0E-07
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 266 355 6.0E-07
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 266 355 7.0E-07
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 266 360 7.0E-07
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 134 335 9.0E-07
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 134 335 1.0E-06
sp|Q5V5F7|RAD25_HALMA Putative DNA helicase Rad25 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rad25 PE=3 SV=2 5 355 2.0E-06
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 47 335 6.0E-06
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 134 335 6.0E-06
sp|Q7NJH7|UVRB_GLOVI UvrABC system protein B OS=Gloeobacter violaceus (strain PCC 7421) GN=uvrB PE=3 SV=1 258 403 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1165
MHPRLQLSRASTLATKLTLRDYQLECIRSVIASLGRGHKRVGISLATGSGKTVIFTQLIDQVGPRSDGKGDRTLI
LAHRRELVEQAARQCQQAYPDKTIDIEMGSLHASGTADITVASVQSITSKDRLVKYDPAAFKLVLVDEAHHIVAS
GYLRTLKHFGLDQKQTESPTLVGVSATFSRFDGLKLGAAIDEIVYHKDYIDMIEDKWLADVILTTVESKANLSKV
RSNSSGDFQTGDLSKVVNTQEVNEITVRTWMAKASDRKSTLVFCVDLAHVAGLTEKFREYGLDARSVTGDTPKLQ
RSRTLDAFKTGHYPILVNCGVFTEGTDIPNIDCIVIGRPTRSRNLLVQMIGRGMRLHPGKQNCHIIDLVSSLDTG
IVTTPTLFGLDPNLLVDKVSVTKIKDQKLQDSSDHQQSNRTDSVTVSNSPIIFTDYSSILDLIADTSGEKHIRAI
SQNAWIQAAPDRYVLSAPSGSYIRLERIQEEDINQPTALYRAVEVRALPPGLGKSPFAARREILTAATFQDAVHG
ADRYAADAFPQTFINRHQPWRSLPATQGQLGFINKIRGKAEPLTAAELTKGRAADMITKIKHGARGQFNKIEAEQ
RRRLRQVSMMDARRNREVVKVGPVAA*
Coding >OphauB2|1165
ATGCACCCAAGATTGCAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAGCTCGAA
TGCATCCGTTCTGTGATTGCATCACTTGGGCGAGGCCATAAACGAGTTGGAATCTCTTTGGCCACGGGCAGCGGC
AAAACAGTCATCTTCACTCAGCTCATTGACCAAGTTGGCCCGCGATCCGACGGCAAAGGAGACCGCACTCTCATC
TTAGCCCATCGCCGCGAATTGGTAGAGCAAGCTGCTCGTCAATGCCAGCAGGCGTATCCAGACAAGACAATCGAC
ATTGAAATGGGCTCTCTTCACGCCTCGGGCACAGCCGACATCACGGTAGCCAGCGTTCAAAGCATCACATCCAAG
GATCGTCTTGTCAAGTACGACCCTGCTGCCTTTAAACTTGTCCTTGTCGATGAAGCCCACCACATTGTCGCTTCA
GGATACCTACGTACCCTCAAGCACTTTGGTCTCGACCAGAAGCAAACGGAGTCGCCGACCCTTGTTGGCGTGTCT
GCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCGCTGCTATTGACGAGATTGTCTACCATAAGGACTATATC
GACATGATCGAGGACAAGTGGCTAGCCGACGTCATTCTGACTACCGTTGAATCCAAGGCAAACCTGTCAAAGGTT
CGCAGTAATTCCAGTGGCGACTTCCAAACCGGAGACTTGTCAAAGGTGGTCAACACGCAAGAGGTCAATGAAATC
ACAGTTCGCACCTGGATGGCCAAGGCCTCTGATCGCAAATCAACGCTGGTATTCTGCGTCGACCTCGCCCATGTT
GCTGGCTTGACCGAAAAGTTTCGTGAATATGGCCTCGACGCAAGGTCCGTCACAGGCGACACGCCCAAGCTGCAA
CGAAGCCGCACTCTAGACGCTTTCAAAACCGGCCATTATCCTATCCTTGTCAACTGTGGCGTCTTTACCGAGGGC
ACTGACATTCCAAACATTGACTGCATCGTCATTGGCCGCCCGACCAGATCACGCAACTTGCTCGTACAAATGATA
GGTCGGGGCATGCGCCTCCACCCAGGCAAGCAGAACTGCCACATTATTGATCTTGTCTCAAGTCTCGACACGGGC
ATCGTTACGACACCTACCCTCTTTGGTCTCGACCCAAATTTGCTCGTGGACAAGGTGTCCGTCACTAAAATCAAG
GATCAAAAATTGCAGGACAGCTCTGATCATCAGCAATCAAATAGAACAGATTCAGTAACTGTCTCCAACAGCCCT
ATAATCTTCACCGACTACTCATCCATACTTGATCTCATTGCCGACACGTCGGGCGAGAAGCACATTCGTGCCATC
AGCCAGAATGCCTGGATCCAGGCCGCTCCGGATCGCTATGTTCTTTCAGCCCCAAGCGGCTCTTACATTCGACTC
GAGCGTATTCAAGAAGAAGACATCAACCAGCCAACCGCTTTATATCGCGCCGTTGAGGTGCGGGCTCTTCCTCCC
GGCTTGGGCAAGTCACCATTTGCCGCGCGCAGAGAGATTCTTACTGCGGCCACTTTTCAAGACGCGGTTCACGGC
GCCGACCGATATGCCGCAGATGCCTTTCCCCAAACCTTCATAAACCGGCACCAGCCTTGGCGCTCGCTGCCAGCA
ACTCAAGGCCAGCTTGGCTTCATCAACAAGATTCGTGGCAAGGCCGAGCCCTTGACAGCTGCCGAATTGACGAAG
GGAAGAGCAGCAGACATGATTACCAAAATCAAGCACGGAGCCCGCGGCCAGTTCAACAAAATCGAGGCTGAGCAG
CGAAGACGGCTCAGACAAGTTTCTATGATGGATGCTAGACGCAACCGCGAAGTCGTAAAGGTCGGGCCTGTGGCA
GCTTGA
Transcript >OphauB2|1165
ATGCACCCAAGATTGCAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAGCTCGAA
TGCATCCGTTCTGTGATTGCATCACTTGGGCGAGGCCATAAACGAGTTGGAATCTCTTTGGCCACGGGCAGCGGC
AAAACAGTCATCTTCACTCAGCTCATTGACCAAGTTGGCCCGCGATCCGACGGCAAAGGAGACCGCACTCTCATC
TTAGCCCATCGCCGCGAATTGGTAGAGCAAGCTGCTCGTCAATGCCAGCAGGCGTATCCAGACAAGACAATCGAC
ATTGAAATGGGCTCTCTTCACGCCTCGGGCACAGCCGACATCACGGTAGCCAGCGTTCAAAGCATCACATCCAAG
GATCGTCTTGTCAAGTACGACCCTGCTGCCTTTAAACTTGTCCTTGTCGATGAAGCCCACCACATTGTCGCTTCA
GGATACCTACGTACCCTCAAGCACTTTGGTCTCGACCAGAAGCAAACGGAGTCGCCGACCCTTGTTGGCGTGTCT
GCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCGCTGCTATTGACGAGATTGTCTACCATAAGGACTATATC
GACATGATCGAGGACAAGTGGCTAGCCGACGTCATTCTGACTACCGTTGAATCCAAGGCAAACCTGTCAAAGGTT
CGCAGTAATTCCAGTGGCGACTTCCAAACCGGAGACTTGTCAAAGGTGGTCAACACGCAAGAGGTCAATGAAATC
ACAGTTCGCACCTGGATGGCCAAGGCCTCTGATCGCAAATCAACGCTGGTATTCTGCGTCGACCTCGCCCATGTT
GCTGGCTTGACCGAAAAGTTTCGTGAATATGGCCTCGACGCAAGGTCCGTCACAGGCGACACGCCCAAGCTGCAA
CGAAGCCGCACTCTAGACGCTTTCAAAACCGGCCATTATCCTATCCTTGTCAACTGTGGCGTCTTTACCGAGGGC
ACTGACATTCCAAACATTGACTGCATCGTCATTGGCCGCCCGACCAGATCACGCAACTTGCTCGTACAAATGATA
GGTCGGGGCATGCGCCTCCACCCAGGCAAGCAGAACTGCCACATTATTGATCTTGTCTCAAGTCTCGACACGGGC
ATCGTTACGACACCTACCCTCTTTGGTCTCGACCCAAATTTGCTCGTGGACAAGGTGTCCGTCACTAAAATCAAG
GATCAAAAATTGCAGGACAGCTCTGATCATCAGCAATCAAATAGAACAGATTCAGTAACTGTCTCCAACAGCCCT
ATAATCTTCACCGACTACTCATCCATACTTGATCTCATTGCCGACACGTCGGGCGAGAAGCACATTCGTGCCATC
AGCCAGAATGCCTGGATCCAGGCCGCTCCGGATCGCTATGTTCTTTCAGCCCCAAGCGGCTCTTACATTCGACTC
GAGCGTATTCAAGAAGAAGACATCAACCAGCCAACCGCTTTATATCGCGCCGTTGAGGTGCGGGCTCTTCCTCCC
GGCTTGGGCAAGTCACCATTTGCCGCGCGCAGAGAGATTCTTACTGCGGCCACTTTTCAAGACGCGGTTCACGGC
GCCGACCGATATGCCGCAGATGCCTTTCCCCAAACCTTCATAAACCGGCACCAGCCTTGGCGCTCGCTGCCAGCA
ACTCAAGGCCAGCTTGGCTTCATCAACAAGATTCGTGGCAAGGCCGAGCCCTTGACAGCTGCCGAATTGACGAAG
GGAAGAGCAGCAGACATGATTACCAAAATCAAGCACGGAGCCCGCGGCCAGTTCAACAAAATCGAGGCTGAGCAG
CGAAGACGGCTCAGACAAGTTTCTATGATGGATGCTAGACGCAACCGCGAAGTCGTAAAGGTCGGGCCTGTGGCA
GCTTGA
Gene >OphauB2|1165
ATGCACCCAAGATTGCAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAGCTCGAA
TGCATCCGTTCTGTGATTGCATCACTTGGGCGAGGCCATAAACGAGTTGGAATCTCTTTGGCCACGGGCAGCGGC
AAAACAGTATGTATACATCACTCTGAATTTTGCTCCTGTTTCCCGTGGCCCTTCTCTTCCCACTGTTACACACAG
CTGCTCATGAACCTCGCATTTTGCTTTTGCCTCTTTGTTCTCATCCTTCAACTTGTCTTGTTCTTTTGTTCAAGC
TGATATGTCCTGTAGGTCATCTTCACTCAGCTCATTGACCAAGTTGGCCCGCGATCCGACGGCAAAGGAGACCGC
ACTCTCATCTTAGCCCATCGCCGCGAATTGGTAGAGCAAGCTGCTCGTCAATGCCAGCAGGCGTATCCAGACAAG
ACAATCGACATTGAAATGGGCTCTCTTCACGCCTCGGGCACAGCCGACATCACGGTAGCCAGCGTTCAAAGCATC
ACATCCAAGGATCGTCTTGTCAAGTACGACCCTGCTGCCTTTAAACTTGTCCTTGTCGATGAAGCCCACCACATT
GTCGCTTCAGGATACCTACGTACCCTCAAGCACTTTGGTCTCGACCAGAAGCAAACGGAGTCGCCGACCCTTGTT
GGCGTGTCTGCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCGCTGCTATTGACGAGATTGTCTACCATAAG
GACTATATCGACATGATCGAGGACAAGTGGCTAGCCGACGTCATTCTGACTACCGTTGAATCCAAGGCAAACCTG
TCAAAGGTTCGCAGTAATTCCAGTGGCGACTTCCAAACCGGAGACTTGTCAAAGGTGGTCAACACGCAAGAGGTC
AATGAAATCACAGTTCGCACCTGGATGGCCAAGGCCTCTGATCGCAAATCAACGCTGGTATTCTGCGTCGACCTC
GCCCATGTTGCTGGCTTGACCGAAAAGTTTCGTGAATATGGCCTCGACGCAAGGTCCGTCACAGGCGACACGCCC
AAGCTGCAACGAAGCCGCACTCTAGACGCTTTCAAAACCGGCCATTATCCTATCCTTGTCAACTGTGGCGTCTTT
ACCGAGGGCACTGACATTCCAAACATTGACTGCATCGTCATTGGCCGCCCGACCAGATCACGCAACTTGCTCGTA
CAAATGATAGGTCGGGGCATGCGCCTCCACCCAGGCAAGCAGAACTGCCACATTATTGATCTTGTCTCAAGTCTC
GACACGGGCATCGTTACGACACCTACCCTCTTTGGTCTCGACCCAAATTTGCTCGTGGACAAGGTGTCCGTCACT
AAAATCAAGGATCAAAAATTGCAGGACAGCTCTGATCATCAGCAATCAAATAGAACAGATTCAGTAACTGTCTCC
AACAGCCCTATAATCTTCACCGACTACTCATCCATACTTGATCTCATTGCCGACACGTCGGGCGAGAAGCACATT
CGTGCCATCAGCCAGAATGCCTGGATCCAGGCCGCTCCGGATCGCTATGTTCTTTCAGCCCCAAGCGGCTCTTAC
ATTCGACTCGAGCGTATTCAAGAAGAAGACATCAACCAGCCAACCGCTTTATATCGCGCCGTTGAGGTGCGGGCT
CTTCCTCCCGGCTTGGGCAAGTCACCATTTGCCGCGCGCAGAGAGATTCTTACTGCGGCCACTTTTCAAGACGCG
GTTCACGGCGCCGACCGATATGCCGCAGATGCCTTTCCCCAAACCTTCATAAACCGGCACCAGCCTTGGCGCTCG
CTGCCAGCAACTCAAGGCCAGCTTGGCTTCATCAACAAGATTCGTGGCAAGGCCGAGCCCTTGACAGCTGCCGAA
TTGACGAAGGGAAGAGCAGCAGACATGATTACCAAAATCAAGCACGGAGCCCGCGGCCAGTTCAACAAAATCGAG
GCTGAGCAGCGAAGACGGCTCAGACAAGTTTCTATGATGGATGCTAGACGCAACCGCGAAGTCGTAAAGGTCGGG
CCTGTGGCAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail