Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1165
Gene name
LocationContig_129:10876..12916
Strand-
Gene length (bp)2040
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 1.9E-24 17 179
PF00271 Helicase_C Helicase conserved C-terminal domain 7.8E-13 258 356
PF00270 DEAD DEAD/DEAH box helicase 4.3E-11 21 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 17 592 3.0E-117
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 19 385 9.0E-106
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 17 371 1.0E-28
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 48 369 2.0E-16
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 15 374 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 17 592 3.0E-117
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 19 385 9.0E-106
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 17 371 1.0E-28
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 48 369 2.0E-16
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 15 374 2.0E-16
sp|Q07736|T1RA_ECOLX Type I restriction enzyme EcoAI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 20 454 3.0E-14
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 17 376 5.0E-14
sp|Q47281|T1RE_ECOLX Type I restriction enzyme EcoEI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 20 413 8.0E-13
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 37 335 1.0E-09
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 37 335 6.0E-09
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 74 335 9.0E-08
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 266 355 4.0E-07
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 266 355 4.0E-07
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 266 355 4.0E-07
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 266 355 4.0E-07
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 266 355 4.0E-07
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 266 355 5.0E-07
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 266 355 5.0E-07
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 266 355 5.0E-07
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 266 355 6.0E-07
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 266 355 6.0E-07
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 266 355 7.0E-07
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 266 360 7.0E-07
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 134 335 9.0E-07
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 134 335 1.0E-06
sp|Q5V5F7|RAD25_HALMA Putative DNA helicase Rad25 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rad25 PE=3 SV=2 5 355 2.0E-06
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 47 335 6.0E-06
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 134 335 6.0E-06
sp|Q7NJH7|UVRB_GLOVI UvrABC system protein B OS=Gloeobacter violaceus (strain PCC 7421) GN=uvrB PE=3 SV=1 258 403 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2520
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4430
Ophiocordyceps australis map64 (Brazil) OphauB2|1165 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04156
Ophiocordyceps camponoti-rufipedis Ophun1|2157
Ophiocordyceps kimflemingae Ophio5|3013
Ophiocordyceps subramaniannii Hirsu2|3685

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1165
MHPRLQLSRASTLATKLTLRDYQLECIRSVIASLGRGHKRVGISLATGSGKTVIFTQLIDQVGPRSDGKGDRTLI
LAHRRELVEQAARQCQQAYPDKTIDIEMGSLHASGTADITVASVQSITSKDRLVKYDPAAFKLVLVDEAHHIVAS
GYLRTLKHFGLDQKQTESPTLVGVSATFSRFDGLKLGAAIDEIVYHKDYIDMIEDKWLADVILTTVESKANLSKV
RSNSSGDFQTGDLSKVVNTQEVNEITVRTWMAKASDRKSTLVFCVDLAHVAGLTEKFREYGLDARSVTGDTPKLQ
RSRTLDAFKTGHYPILVNCGVFTEGTDIPNIDCIVIGRPTRSRNLLVQMIGRGMRLHPGKQNCHIIDLVSSLDTG
IVTTPTLFGLDPNLLVDKVSVTKIKDQKLQDSSDHQQSNRTDSVTVSNSPIIFTDYSSILDLIADTSGEKHIRAI
SQNAWIQAAPDRYVLSAPSGSYIRLERIQEEDINQPTALYRAVEVRALPPGLGKSPFAARREILTAATFQDAVHG
ADRYAADAFPQTFINRHQPWRSLPATQGQLGFINKIRGKAEPLTAAELTKGRAADMITKIKHGARGQFNKIEAEQ
RRRLRQVSMMDARRNREVVKVGPVAA*
Coding >OphauB2|1165
ATGCACCCAAGATTGCAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAGCTCGAA
TGCATCCGTTCTGTGATTGCATCACTTGGGCGAGGCCATAAACGAGTTGGAATCTCTTTGGCCACGGGCAGCGGC
AAAACAGTCATCTTCACTCAGCTCATTGACCAAGTTGGCCCGCGATCCGACGGCAAAGGAGACCGCACTCTCATC
TTAGCCCATCGCCGCGAATTGGTAGAGCAAGCTGCTCGTCAATGCCAGCAGGCGTATCCAGACAAGACAATCGAC
ATTGAAATGGGCTCTCTTCACGCCTCGGGCACAGCCGACATCACGGTAGCCAGCGTTCAAAGCATCACATCCAAG
GATCGTCTTGTCAAGTACGACCCTGCTGCCTTTAAACTTGTCCTTGTCGATGAAGCCCACCACATTGTCGCTTCA
GGATACCTACGTACCCTCAAGCACTTTGGTCTCGACCAGAAGCAAACGGAGTCGCCGACCCTTGTTGGCGTGTCT
GCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCGCTGCTATTGACGAGATTGTCTACCATAAGGACTATATC
GACATGATCGAGGACAAGTGGCTAGCCGACGTCATTCTGACTACCGTTGAATCCAAGGCAAACCTGTCAAAGGTT
CGCAGTAATTCCAGTGGCGACTTCCAAACCGGAGACTTGTCAAAGGTGGTCAACACGCAAGAGGTCAATGAAATC
ACAGTTCGCACCTGGATGGCCAAGGCCTCTGATCGCAAATCAACGCTGGTATTCTGCGTCGACCTCGCCCATGTT
GCTGGCTTGACCGAAAAGTTTCGTGAATATGGCCTCGACGCAAGGTCCGTCACAGGCGACACGCCCAAGCTGCAA
CGAAGCCGCACTCTAGACGCTTTCAAAACCGGCCATTATCCTATCCTTGTCAACTGTGGCGTCTTTACCGAGGGC
ACTGACATTCCAAACATTGACTGCATCGTCATTGGCCGCCCGACCAGATCACGCAACTTGCTCGTACAAATGATA
GGTCGGGGCATGCGCCTCCACCCAGGCAAGCAGAACTGCCACATTATTGATCTTGTCTCAAGTCTCGACACGGGC
ATCGTTACGACACCTACCCTCTTTGGTCTCGACCCAAATTTGCTCGTGGACAAGGTGTCCGTCACTAAAATCAAG
GATCAAAAATTGCAGGACAGCTCTGATCATCAGCAATCAAATAGAACAGATTCAGTAACTGTCTCCAACAGCCCT
ATAATCTTCACCGACTACTCATCCATACTTGATCTCATTGCCGACACGTCGGGCGAGAAGCACATTCGTGCCATC
AGCCAGAATGCCTGGATCCAGGCCGCTCCGGATCGCTATGTTCTTTCAGCCCCAAGCGGCTCTTACATTCGACTC
GAGCGTATTCAAGAAGAAGACATCAACCAGCCAACCGCTTTATATCGCGCCGTTGAGGTGCGGGCTCTTCCTCCC
GGCTTGGGCAAGTCACCATTTGCCGCGCGCAGAGAGATTCTTACTGCGGCCACTTTTCAAGACGCGGTTCACGGC
GCCGACCGATATGCCGCAGATGCCTTTCCCCAAACCTTCATAAACCGGCACCAGCCTTGGCGCTCGCTGCCAGCA
ACTCAAGGCCAGCTTGGCTTCATCAACAAGATTCGTGGCAAGGCCGAGCCCTTGACAGCTGCCGAATTGACGAAG
GGAAGAGCAGCAGACATGATTACCAAAATCAAGCACGGAGCCCGCGGCCAGTTCAACAAAATCGAGGCTGAGCAG
CGAAGACGGCTCAGACAAGTTTCTATGATGGATGCTAGACGCAACCGCGAAGTCGTAAAGGTCGGGCCTGTGGCA
GCTTGA
Transcript >OphauB2|1165
ATGCACCCAAGATTGCAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAGCTCGAA
TGCATCCGTTCTGTGATTGCATCACTTGGGCGAGGCCATAAACGAGTTGGAATCTCTTTGGCCACGGGCAGCGGC
AAAACAGTCATCTTCACTCAGCTCATTGACCAAGTTGGCCCGCGATCCGACGGCAAAGGAGACCGCACTCTCATC
TTAGCCCATCGCCGCGAATTGGTAGAGCAAGCTGCTCGTCAATGCCAGCAGGCGTATCCAGACAAGACAATCGAC
ATTGAAATGGGCTCTCTTCACGCCTCGGGCACAGCCGACATCACGGTAGCCAGCGTTCAAAGCATCACATCCAAG
GATCGTCTTGTCAAGTACGACCCTGCTGCCTTTAAACTTGTCCTTGTCGATGAAGCCCACCACATTGTCGCTTCA
GGATACCTACGTACCCTCAAGCACTTTGGTCTCGACCAGAAGCAAACGGAGTCGCCGACCCTTGTTGGCGTGTCT
GCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCGCTGCTATTGACGAGATTGTCTACCATAAGGACTATATC
GACATGATCGAGGACAAGTGGCTAGCCGACGTCATTCTGACTACCGTTGAATCCAAGGCAAACCTGTCAAAGGTT
CGCAGTAATTCCAGTGGCGACTTCCAAACCGGAGACTTGTCAAAGGTGGTCAACACGCAAGAGGTCAATGAAATC
ACAGTTCGCACCTGGATGGCCAAGGCCTCTGATCGCAAATCAACGCTGGTATTCTGCGTCGACCTCGCCCATGTT
GCTGGCTTGACCGAAAAGTTTCGTGAATATGGCCTCGACGCAAGGTCCGTCACAGGCGACACGCCCAAGCTGCAA
CGAAGCCGCACTCTAGACGCTTTCAAAACCGGCCATTATCCTATCCTTGTCAACTGTGGCGTCTTTACCGAGGGC
ACTGACATTCCAAACATTGACTGCATCGTCATTGGCCGCCCGACCAGATCACGCAACTTGCTCGTACAAATGATA
GGTCGGGGCATGCGCCTCCACCCAGGCAAGCAGAACTGCCACATTATTGATCTTGTCTCAAGTCTCGACACGGGC
ATCGTTACGACACCTACCCTCTTTGGTCTCGACCCAAATTTGCTCGTGGACAAGGTGTCCGTCACTAAAATCAAG
GATCAAAAATTGCAGGACAGCTCTGATCATCAGCAATCAAATAGAACAGATTCAGTAACTGTCTCCAACAGCCCT
ATAATCTTCACCGACTACTCATCCATACTTGATCTCATTGCCGACACGTCGGGCGAGAAGCACATTCGTGCCATC
AGCCAGAATGCCTGGATCCAGGCCGCTCCGGATCGCTATGTTCTTTCAGCCCCAAGCGGCTCTTACATTCGACTC
GAGCGTATTCAAGAAGAAGACATCAACCAGCCAACCGCTTTATATCGCGCCGTTGAGGTGCGGGCTCTTCCTCCC
GGCTTGGGCAAGTCACCATTTGCCGCGCGCAGAGAGATTCTTACTGCGGCCACTTTTCAAGACGCGGTTCACGGC
GCCGACCGATATGCCGCAGATGCCTTTCCCCAAACCTTCATAAACCGGCACCAGCCTTGGCGCTCGCTGCCAGCA
ACTCAAGGCCAGCTTGGCTTCATCAACAAGATTCGTGGCAAGGCCGAGCCCTTGACAGCTGCCGAATTGACGAAG
GGAAGAGCAGCAGACATGATTACCAAAATCAAGCACGGAGCCCGCGGCCAGTTCAACAAAATCGAGGCTGAGCAG
CGAAGACGGCTCAGACAAGTTTCTATGATGGATGCTAGACGCAACCGCGAAGTCGTAAAGGTCGGGCCTGTGGCA
GCTTGA
Gene >OphauB2|1165
ATGCACCCAAGATTGCAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAGCTCGAA
TGCATCCGTTCTGTGATTGCATCACTTGGGCGAGGCCATAAACGAGTTGGAATCTCTTTGGCCACGGGCAGCGGC
AAAACAGTATGTATACATCACTCTGAATTTTGCTCCTGTTTCCCGTGGCCCTTCTCTTCCCACTGTTACACACAG
CTGCTCATGAACCTCGCATTTTGCTTTTGCCTCTTTGTTCTCATCCTTCAACTTGTCTTGTTCTTTTGTTCAAGC
TGATATGTCCTGTAGGTCATCTTCACTCAGCTCATTGACCAAGTTGGCCCGCGATCCGACGGCAAAGGAGACCGC
ACTCTCATCTTAGCCCATCGCCGCGAATTGGTAGAGCAAGCTGCTCGTCAATGCCAGCAGGCGTATCCAGACAAG
ACAATCGACATTGAAATGGGCTCTCTTCACGCCTCGGGCACAGCCGACATCACGGTAGCCAGCGTTCAAAGCATC
ACATCCAAGGATCGTCTTGTCAAGTACGACCCTGCTGCCTTTAAACTTGTCCTTGTCGATGAAGCCCACCACATT
GTCGCTTCAGGATACCTACGTACCCTCAAGCACTTTGGTCTCGACCAGAAGCAAACGGAGTCGCCGACCCTTGTT
GGCGTGTCTGCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCGCTGCTATTGACGAGATTGTCTACCATAAG
GACTATATCGACATGATCGAGGACAAGTGGCTAGCCGACGTCATTCTGACTACCGTTGAATCCAAGGCAAACCTG
TCAAAGGTTCGCAGTAATTCCAGTGGCGACTTCCAAACCGGAGACTTGTCAAAGGTGGTCAACACGCAAGAGGTC
AATGAAATCACAGTTCGCACCTGGATGGCCAAGGCCTCTGATCGCAAATCAACGCTGGTATTCTGCGTCGACCTC
GCCCATGTTGCTGGCTTGACCGAAAAGTTTCGTGAATATGGCCTCGACGCAAGGTCCGTCACAGGCGACACGCCC
AAGCTGCAACGAAGCCGCACTCTAGACGCTTTCAAAACCGGCCATTATCCTATCCTTGTCAACTGTGGCGTCTTT
ACCGAGGGCACTGACATTCCAAACATTGACTGCATCGTCATTGGCCGCCCGACCAGATCACGCAACTTGCTCGTA
CAAATGATAGGTCGGGGCATGCGCCTCCACCCAGGCAAGCAGAACTGCCACATTATTGATCTTGTCTCAAGTCTC
GACACGGGCATCGTTACGACACCTACCCTCTTTGGTCTCGACCCAAATTTGCTCGTGGACAAGGTGTCCGTCACT
AAAATCAAGGATCAAAAATTGCAGGACAGCTCTGATCATCAGCAATCAAATAGAACAGATTCAGTAACTGTCTCC
AACAGCCCTATAATCTTCACCGACTACTCATCCATACTTGATCTCATTGCCGACACGTCGGGCGAGAAGCACATT
CGTGCCATCAGCCAGAATGCCTGGATCCAGGCCGCTCCGGATCGCTATGTTCTTTCAGCCCCAAGCGGCTCTTAC
ATTCGACTCGAGCGTATTCAAGAAGAAGACATCAACCAGCCAACCGCTTTATATCGCGCCGTTGAGGTGCGGGCT
CTTCCTCCCGGCTTGGGCAAGTCACCATTTGCCGCGCGCAGAGAGATTCTTACTGCGGCCACTTTTCAAGACGCG
GTTCACGGCGCCGACCGATATGCCGCAGATGCCTTTCCCCAAACCTTCATAAACCGGCACCAGCCTTGGCGCTCG
CTGCCAGCAACTCAAGGCCAGCTTGGCTTCATCAACAAGATTCGTGGCAAGGCCGAGCCCTTGACAGCTGCCGAA
TTGACGAAGGGAAGAGCAGCAGACATGATTACCAAAATCAAGCACGGAGCCCGCGGCCAGTTCAACAAAATCGAG
GCTGAGCAGCGAAGACGGCTCAGACAAGTTTCTATGATGGATGCTAGACGCAACCGCGAAGTCGTAAAGGTCGGG
CCTGTGGCAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail