Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1155
Gene name
LocationContig_128:41393..42873
Strand+
Gene length (bp)1480
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04056 Ssl1 Ssl1-like 9.3E-71 109 306
PF13519 VWA_2 von Willebrand factor type A domain 2.3E-16 106 215
PF07975 C1_4 TFIIH C1-like domain 2.6E-16 386 456

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74995|TFH47_SCHPO TFIIH basal transcription factor complex p47 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfh47 PE=1 SV=1 21 455 4.0E-145
sp|Q04673|SSL1_YEAST Suppressor of stem-loop protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL1 PE=1 SV=1 11 457 3.0E-130
sp|Q2TBV5|TF2H2_BOVIN General transcription factor IIH subunit 2 OS=Bos taurus GN=GTF2H2 PE=2 SV=1 50 454 8.0E-84
sp|A0JN27|TF2H2_RAT General transcription factor IIH subunit 2 OS=Rattus norvegicus GN=Gtf2h2 PE=1 SV=1 50 454 1.0E-81
sp|Q86KZ2|TF2H2_DICDI General transcription factor IIH subunit 2 OS=Dictyostelium discoideum GN=gtf2h2 PE=3 SV=2 26 456 6.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74995|TFH47_SCHPO TFIIH basal transcription factor complex p47 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfh47 PE=1 SV=1 21 455 4.0E-145
sp|Q04673|SSL1_YEAST Suppressor of stem-loop protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL1 PE=1 SV=1 11 457 3.0E-130
sp|Q2TBV5|TF2H2_BOVIN General transcription factor IIH subunit 2 OS=Bos taurus GN=GTF2H2 PE=2 SV=1 50 454 8.0E-84
sp|A0JN27|TF2H2_RAT General transcription factor IIH subunit 2 OS=Rattus norvegicus GN=Gtf2h2 PE=1 SV=1 50 454 1.0E-81
sp|Q86KZ2|TF2H2_DICDI General transcription factor IIH subunit 2 OS=Dictyostelium discoideum GN=gtf2h2 PE=3 SV=2 26 456 6.0E-80
sp|Q9JIB4|TF2H2_MOUSE General transcription factor IIH subunit 2 OS=Mus musculus GN=Gtf2h2 PE=1 SV=1 50 454 9.0E-80
sp|Q6P1K8|T2H2L_HUMAN General transcription factor IIH subunit 2-like protein OS=Homo sapiens GN=GTF2H2C PE=1 SV=1 50 454 2.0E-79
sp|Q13888|TF2H2_HUMAN General transcription factor IIH subunit 2 OS=Homo sapiens GN=GTF2H2 PE=1 SV=1 50 454 5.0E-79
sp|P34567|TF2H2_CAEEL General transcription factor IIH subunit 2 OS=Caenorhabditis elegans GN=T16H12.4 PE=3 SV=3 59 455 4.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006281 DNA repair Yes
GO:0051716 cellular response to stimulus No
GO:0046914 transition metal ion binding No
GO:0043170 macromolecule metabolic process No
GO:0006950 response to stress No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0090304 nucleic acid metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1155
MADSDGEFVAEGMSDDDVHDVNLSDDDEDRRRGPGKAGQPRGRKRRRRGERASAQQAWEKSKRSWETNLPDEDED
GVLKLTALEAERRRRLLRDTTPLQRGIIRHMVLVIDMSFAMADKDMLPTRYRLTLGYAAAFVDDYFEQNPISQLA
IVGMRDGIAVRISDLGGNPAEHLERLRTLQEQEPQGNPSLQNALEMCRGALFHAPSHGTREVLVIYGALLSSDPG
DIHDTMASLVADGIRVSIVGLSAQVAICAQLCARTNGGHDGHYRVAMDEVHLRELVLAATTPPITRTAHVGAASL
LIMGFPSRTLGPAGAPGFCACHSRPCREAYACTRCAARVCRLPAQCPACGLTLILSTHLARSYHHLFPLRNWVEV
TWPDAVRSTACFACQAPFPDAQSRLSRAHASQDPSGHLAQSMPKGVSESGRYACPICACHFCIDCDVFAHQVVHN
CPGCQSNQRPSTAMANGAMDLDP*
Coding >OphauB2|1155
ATGGCAGACTCGGATGGCGAGTTTGTGGCCGAGGGCATGTCGGACGATGATGTTCACGACGTCAACTTGAGCGAC
GACGACGAGGACAGACGGCGAGGGCCAGGCAAAGCAGGGCAGCCACGAGGGCGAAAACGACGGCGGCGAGGCGAG
CGGGCATCGGCGCAGCAGGCGTGGGAAAAGTCGAAGCGGTCATGGGAGACAAACCTGCCCGACGAGGACGAGGAC
GGGGTGCTCAAGCTGACGGCTCTCGAGGCGGAGCGGCGGCGACGGCTGCTGCGAGACACGACGCCGCTGCAGCGA
GGCATCATCCGGCACATGGTGCTCGTCATTGACATGTCGTTTGCCATGGCGGACAAGGACATGCTGCCGACGCGC
TACCGGCTGACGCTGGGATACGCGGCGGCCTTTGTGGACGACTATTTTGAGCAGAACCCCATTTCGCAGCTGGCC
ATTGTGGGCATGCGCGACGGCATCGCGGTGCGCATCAGCGACCTTGGGGGAAACCCGGCCGAGCACCTCGAGCGG
CTGCGGACGCTGCAAGAGCAGGAGCCGCAGGGCAACCCCAGCCTGCAAAACGCCCTCGAGATGTGCCGCGGCGCT
CTGTTCCACGCGCCCTCGCATGGCACGCGCGAGGTGCTCGTCATCTACGGCGCCCTCTTGTCGAGCGATCCAGGC
GACATACACGACACCATGGCCAGCCTCGTGGCCGACGGCATCCGCGTCTCCATTGTCGGCCTGTCGGCCCAGGTG
GCCATCTGCGCCCAGCTGTGCGCCCGCACCAACGGCGGCCATGACGGCCACTACCGCGTCGCCATGGACGAGGTG
CATCTGCGCGAGCTGGTCCTCGCCGCCACCACGCCGCCCATTACCCGCACAGCCCATGTTGGCGCCGCCAGCCTG
CTCATCATGGGCTTCCCCTCGCGCACTCTTGGGCCCGCCGGCGCCCCTGGCTTTTGCGCCTGCCACAGCCGTCCC
TGTCGCGAGGCTTATGCCTGCACCCGCTGTGCCGCCCGCGTCTGCCGCCTGCCCGCCCAGTGTCCCGCCTGTGGC
CTCACCCTTATTCTCTCCACCCATCTCGCCCGCTCCTACCACCATCTCTTCCCCCTGCGCAACTGGGTCGAGGTG
ACCTGGCCCGACGCTGTGCGCTCCACTGCTTGCTTTGCCTGCCAGGCTCCCTTTCCCGACGCCCAGTCGCGCCTC
TCGAGAGCCCATGCCTCTCAAGACCCTTCCGGCCACCTGGCCCAATCCATGCCCAAGGGCGTCAGTGAGAGCGGC
CGCTACGCATGCCCAATCTGTGCATGTCACTTCTGCATCGACTGCGACGTCTTTGCCCACCAAGTTGTTCACAAC
TGCCCCGGTTGTCAGAGCAACCAGCGCCCCTCGACAGCAATGGCAAACGGCGCCATGGACTTGGATCCCTAG
Transcript >OphauB2|1155
ATGGCAGACTCGGATGGCGAGTTTGTGGCCGAGGGCATGTCGGACGATGATGTTCACGACGTCAACTTGAGCGAC
GACGACGAGGACAGACGGCGAGGGCCAGGCAAAGCAGGGCAGCCACGAGGGCGAAAACGACGGCGGCGAGGCGAG
CGGGCATCGGCGCAGCAGGCGTGGGAAAAGTCGAAGCGGTCATGGGAGACAAACCTGCCCGACGAGGACGAGGAC
GGGGTGCTCAAGCTGACGGCTCTCGAGGCGGAGCGGCGGCGACGGCTGCTGCGAGACACGACGCCGCTGCAGCGA
GGCATCATCCGGCACATGGTGCTCGTCATTGACATGTCGTTTGCCATGGCGGACAAGGACATGCTGCCGACGCGC
TACCGGCTGACGCTGGGATACGCGGCGGCCTTTGTGGACGACTATTTTGAGCAGAACCCCATTTCGCAGCTGGCC
ATTGTGGGCATGCGCGACGGCATCGCGGTGCGCATCAGCGACCTTGGGGGAAACCCGGCCGAGCACCTCGAGCGG
CTGCGGACGCTGCAAGAGCAGGAGCCGCAGGGCAACCCCAGCCTGCAAAACGCCCTCGAGATGTGCCGCGGCGCT
CTGTTCCACGCGCCCTCGCATGGCACGCGCGAGGTGCTCGTCATCTACGGCGCCCTCTTGTCGAGCGATCCAGGC
GACATACACGACACCATGGCCAGCCTCGTGGCCGACGGCATCCGCGTCTCCATTGTCGGCCTGTCGGCCCAGGTG
GCCATCTGCGCCCAGCTGTGCGCCCGCACCAACGGCGGCCATGACGGCCACTACCGCGTCGCCATGGACGAGGTG
CATCTGCGCGAGCTGGTCCTCGCCGCCACCACGCCGCCCATTACCCGCACAGCCCATGTTGGCGCCGCCAGCCTG
CTCATCATGGGCTTCCCCTCGCGCACTCTTGGGCCCGCCGGCGCCCCTGGCTTTTGCGCCTGCCACAGCCGTCCC
TGTCGCGAGGCTTATGCCTGCACCCGCTGTGCCGCCCGCGTCTGCCGCCTGCCCGCCCAGTGTCCCGCCTGTGGC
CTCACCCTTATTCTCTCCACCCATCTCGCCCGCTCCTACCACCATCTCTTCCCCCTGCGCAACTGGGTCGAGGTG
ACCTGGCCCGACGCTGTGCGCTCCACTGCTTGCTTTGCCTGCCAGGCTCCCTTTCCCGACGCCCAGTCGCGCCTC
TCGAGAGCCCATGCCTCTCAAGACCCTTCCGGCCACCTGGCCCAATCCATGCCCAAGGGCGTCAGTGAGAGCGGC
CGCTACGCATGCCCAATCTGTGCATGTCACTTCTGCATCGACTGCGACGTCTTTGCCCACCAAGTTGTTCACAAC
TGCCCCGGTTGTCAGAGCAACCAGCGCCCCTCGACAGCAATGGCAAACGGCGCCATGGACTTGGATCCCTAG
Gene >OphauB2|1155
ATGGCAGACTCGGATGGCGAGTTTGTGGCCGAGGGCATGTCGGACGATGATGTTCACGACGTCAACTTGAGCGAC
GACGACGAGGACAGACGGCGAGGGCCAGGCAAAGCAGGGCAGCCACGAGGGCGAAAACGACGGCGGCGAGGCGAG
CGGGCATCGGCGCAGCAGGCGTGGGAAAAGTCGAAGCGGTCATGGGAGACAAACCTGCCCGACGAGGACGAGGAC
GGGGTGCTCAAGCTGACGGCTCTCGAGGCGGAGCGGCGGCGACGGCTGCTGCGAGACACGACGCCGCTGCAGCGA
GGCATCATCCGGCACATGGTGCTCGTCATTGACATGTCGTTTGCCATGGCGGACAAGGACATGCTGCCGACGCGC
TACCGGCTGACGCTGGGATACGCGGCGGCCTTTGTGGACGACTATTTTGAGCAGAACCCCATTTCGCAGCTGGCC
ATTGTGGGCATGCGCGACGGCATCGCGGTGCGCATCAGCGACCTTGGGGGAAACCCGGCCGAGCACCTCGAGCGG
CTGCGGACGCTGCAAGAGCAGGAGCCGCAGGGCAACCCCAGCCTGCAAAACGCCCTCGAGATGTGCCGCGGCGCT
CTGTTGTAGGTGCCCCTGGTGCTTCATTGCTGGCTCCAGCCCAGCAGCTGACTCTGGCCACAGCCACGCGCCCTC
GCATGGCACGCGCGAGGTGCTCGTCATCTACGGCGCCCTCTTGTCGAGCGATCCAGGCGACATACACGACACCAT
GGCCAGCCTCGTGGCCGACGGCATCCGCGTCTCCATTGTCGGCCTGTCGGCCCAGGTGGCCATCTGCGCCCAGCT
GTGCGCCCGCACCAACGGCGGCCATGACGGCCACTACCGCGTCGCCATGGACGAGGTGCATCTGCGCGAGCTGGT
CCTCGCCGCCACCACGCCGCCCATTACCCGCACAGCCCATGTTGGCGCCGCCAGCCTGCTCATCATGGGCTTCCC
CTCGCGCACTCTTGGGCCCGCCGGCGCCCCTGGCTTTTGCGCCTGCCACAGCCGTCCCTGTCGCGAGGCTTATGC
CTGCACCCGCTGTGCCGCCCGCGTCTGCCGCCTGCCCGCCCAGTGTCCCGCCTGTGGCCTCACCCTTATTCTCTC
CACCCATCTCGCCCGCTCCTACCACCATCTCTTCCCCCTGCGCAACTGGGTCGAGGTGACCTGGCCCGACGCTGT
GCGCTCCACTGCTTGCTTTGCCTGCCAGGCTCCCTTTCCCGACGCCCAGTCGCGCCTCTCGAGAGCCCATGCCTC
TCAAGACCCTTCCGGCCACCTGGCCCAATCCATGCCCAAGGGCGTCAGTGAGAGCGGCCGCTACGCATGCCCAAT
CTGTGCATGTCACTTCTGCATCGACTGCGACGTCTTTGCCCACCAAGTTGTTCACAACTGCCCCGGTTGTCAGAG
CAACCAGCGCCCCTCGACAGCAATGGCAAACGGCGCCATGGACTTGGATCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail