Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|115
Gene name
LocationContig_1:296624..297139
Strand-
Gene length (bp)515
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05899 Cupin_3 EutQ-like cupin domain 4.0E-06 58 99
PF06249 EutQ Ethanolamine utilisation protein EutQ 9.0E-06 58 106

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03858
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044
Ophiocordyceps camponoti-rufipedis Ophun1|7452
Ophiocordyceps kimflemingae Ophio5|1649
Ophiocordyceps kimflemingae Ophio5|4067
Ophiocordyceps subramaniannii Hirsu2|1745
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|115
MVFEWKGQEQFHRVPKLEPGPPNVYFSDVFSVPKDASNPLTASLFLLEKLDKPEPAPKYAYDETGVVLQGELHIV
DEKGNQAKLLPGDTFFVHRGSTITFSTPRFAVAYKAASRHAH*
Coding >OphauB2|115
ATGGTTTTCGAGTGGAAAGGACAGGAACAATTCCACAGAGTCCCCAAGCTAGAGCCCGGCCCGCCCAACGTCTAC
TTTAGCGATGTCTTTTCCGTGCCCAAGGATGCATCCAATCCTCTAACCGCGTCTCTTTTCCTTCTCGAGAAGCTG
GATAAGCCCGAGCCGGCGCCCAAGTATGCATACGACGAAACTGGGGTAGTTCTTCAAGGCGAACTCCACATTGTG
GACGAAAAGGGCAACCAAGCAAAGCTCTTGCCAGGCGACACCTTTTTTGTCCACCGTGGCAGCACTATTACCTTT
TCCACGCCGCGCTTTGCCGTTGCCTACAAGGCTGCCTCGCGTCATGCGCACTAG
Transcript >OphauB2|115
ATGGTTTTCGAGTGGAAAGGACAGGAACAATTCCACAGAGTCCCCAAGCTAGAGCCCGGCCCGCCCAACGTCTAC
TTTAGCGATGTCTTTTCCGTGCCCAAGGATGCATCCAATCCTCTAACCGCGTCTCTTTTCCTTCTCGAGAAGCTG
GATAAGCCCGAGCCGGCGCCCAAGTATGCATACGACGAAACTGGGGTAGTTCTTCAAGGCGAACTCCACATTGTG
GACGAAAAGGGCAACCAAGCAAAGCTCTTGCCAGGCGACACCTTTTTTGTCCACCGTGGCAGCACTATTACCTTT
TCCACGCCGCGCTTTGCCGTTGCCTACAAGGCTGCCTCGCGTCATGCGCACTAG
Gene >OphauB2|115
ATGGTTTTCGAGTGGAAAGGACAGGAACAATTCCACAGAGTCCCCAAGCTAGAGCCCGGCCCGCCCAACGTCTAC
TTTAGTAAGCCCCTCCCCCGTTGCTCCTTGCCCATCGAGGCTAACCCTAGGCCCCTAGGCGATGTCTTTTCCGTG
CCCAAGGATGCATCCAATCCTCTAACCGCGTCTCTTTTCCTTCTCGAGAAGCTGGATAAGCCCGAGCCGGCGCCC
AAGTATGCATACGACGAAACTGGGGTAGTTCTTCAAGGTATGTCTCTGCCACTGCCCATTGCCTTGATTACTGCC
TCTTCAAATACTGTCTCGTGTCTCCAACTCTGCCTCATCTCAAATCATCTGTGCTAAAACACTAGCCAGGCGAAC
TCCACATTGTGGACGAAAAGGGCAACCAAGCAAAGCTCTTGCCAGGCGACACCTTTTTTGTCCACCGTGGCAGCA
CTATTACCTTTTCCACGCCGCGCTTTGCCGTTGCCTACAAGGCTGCCTCGCGTCATGCGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail