Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1144
Gene name
LocationContig_128:12068..18226
Strand+
Gene length (bp)6158
Transcript length (bp)6096
Coding sequence length (bp)6096
Protein length (aa) 2032

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16172 DOCK_N DOCK N-terminus 1.1E-119 169 596
PF14429 DOCK-C2 C2 domain in Dock180 and Zizimin proteins 7.0E-38 600 794
PF00018 SH3_1 SH3 domain 1.4E-05 13 48

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus GN=Dock1 PE=1 SV=3 539 1717 3.0E-86
sp|Q14185|DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens GN=DOCK1 PE=1 SV=2 539 1717 2.0E-85
sp|Q8N1I0|DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens GN=DOCK4 PE=1 SV=3 481 1765 7.0E-80
sp|P59764|DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus GN=Dock4 PE=1 SV=1 481 1765 4.0E-77
sp|Q92608|DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens GN=DOCK2 PE=1 SV=2 486 1761 3.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus GN=Dock1 PE=1 SV=3 539 1717 3.0E-86
sp|Q14185|DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens GN=DOCK1 PE=1 SV=2 539 1717 2.0E-85
sp|Q8N1I0|DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens GN=DOCK4 PE=1 SV=3 481 1765 7.0E-80
sp|P59764|DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus GN=Dock4 PE=1 SV=1 481 1765 4.0E-77
sp|Q92608|DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens GN=DOCK2 PE=1 SV=2 486 1761 3.0E-72
sp|Q8C3J5|DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus GN=Dock2 PE=1 SV=3 492 1761 1.0E-71
sp|Q9H7D0|DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens GN=DOCK5 PE=1 SV=3 534 1717 5.0E-71
sp|B2RY04|DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus GN=Dock5 PE=1 SV=2 1187 1697 2.0E-45
sp|Q8CIQ7|DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus GN=Dock3 PE=1 SV=1 1164 1765 2.0E-44
sp|Q8IZD9|DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens GN=DOCK3 PE=1 SV=1 1164 1765 6.0E-44
sp|Q06409|YL422_YEAST DOCK-like protein YLR422W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR422W PE=1 SV=1 849 1854 2.0E-38
sp|B2RY04|DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus GN=Dock5 PE=1 SV=2 534 1037 5.0E-27
sp|Q8CIQ7|DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus GN=Dock3 PE=1 SV=1 533 1060 2.0E-24
sp|Q8IZD9|DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens GN=DOCK3 PE=1 SV=1 495 1060 6.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1144
MPWQPLPRIAFAVATYPFAAESPAELPLEIGDELYIIEETPEGDWLRGYLVAPPSLLAGLTSVKGQTLEARVFSG
IFPRSCVEVRELLGESDIRHGANGNGYGEEAASDSAKSGITYDNSPTKEQSNDKAARFSDPRKPLRELCNGAPGT
LSIPVKRDPNAPRPAAPVPMLKIGDENPTSASEPLIDEISSCLREWHSKNLHQLLLSRKYAELDQLSQVINRLNL
SRQQFLYNVLTGREYEHLRERTVWDLVNVNKKCGGEVIVRDPAARGRVLTAEDSAVEMTRLQSLMSLLDEPPQPV
AELSSLHHILLEVKGFAGSCNEETTLNLFLVSKPNHDKATNLTECFSVKIPSGGAIGGLAQDSSTRTLFTDLSGH
DIGESPSADSSIYLVVKVLSSQQIVSSAPLSRSGMGADTATSKDQYKSNSTGGHRSSRRSLMWGRSTLSRGQTAP
RLDSVPEGQQDLSTATASGNRDQHIPPSTAGSAADGTATQVQMVQRTVGIGALRLNSLVKQDGQVEEVINIWSPS
TRQAQHSSEDEELDSLMREVMDKANGQFDKSRRGERLQVCLQAFNHGDADALIRCTPTLLAGVSQTSRMGFCGAP
SKPRSDIYLTIKTAALSRQHLLSRYGGSATSITPGLQGNNLQVSVEVRGPLGQKLEKCIYASSNHEGVTRFKSAV
AERGESWNQTIRLSLQADDVPTAHVLIMVSEVPHAPFAVAHMPLWDQQAFVHDERHGLLLYRIDENTSTAKAGPT
GKGGYLSLPWALRGKGQHSAEVTGPLAVIVVESFLCSTRFSQDRVILGILKWKELSHEDLTWVLRQVMFVAEMEV
VKVLKEVLDGLFGVIAENAGNEELEDLVFTALVRVLDIVHDRRFKLGPLVEQYAEKQFHYPYATSSLISTFTRLL
EKPAEPETARKLRATFKVVRHIFKLMSQARVQMREKEAVIGITSSSQSFTRQLRSIFEGLNGMMRNSAAALVGSQ
TLAVQHFHTWLPELRGLLSGEEIVHIAIDFMDSCMQVKGKLILYKLVLIINYSKLELFGQGEQAAALCANTVRWI
APHWGATEEVDEQWRSQVRLCCSVVASQVKHLGAEIPDHLGKIVDSYLGLVGRGHKGRERERERGRVSLLFPTSY
PFPSKATRQRLEQDEALAELAAVLAAVSSSRGGMQLELAEGDLTVLVEKLLRVHLSILEGEAFPAGWLSVQMYHA
KWSMATLQYLADIMLASFVPEAEEAESFKTELWKLLLTTLVKLVASEKLALETFAEQKRRAVWKIAGDVREQGAE
LLRKTWEAIGWEASSEEQESYGLERIGGYQVQYVPTLVGPIVELCLSVHEGLRRTAVQVLQTMIVSEWALSQDLS
AVQTEMVDCLDHIFKTRPLTESMLQKLFVAELLQRFERLAADEALYPAMQQLVARVDEFVDLLVAVHSSHEADDV
STIINRLRLMEFLRDMQKEDIFIRYVHQLARSQAQAGNQAEAGLALRLHADLYDWEPLKQTPALADPCLPAQSMF
ERKELLYFDMIKHFEEGESWSNALTAYKELQTQYEANVFDFAKLARTQRAIATIYHDLTASHAILPPYFKVVYKG
LGFPPTLRDKGFIYQGSLAERPDAFADRMQEQYPSAHIITAAHTDEVEGQYLLVSALTPLRDWSHPVYQRPRVPP
EARDFLLCSHPQAFSFTTQRHTVGPVHQHYAQKLVFCTAEPFPTLLRRSEIVDMYPLSLDARQTALERIVRKTYE
MTALERRLAAGNDQDAQLLLDAVSVSLNAASEHSVVCYRKLLPESQPPDADADADDDDDDDDDDDDEQQPPELEP
RDVAVKMALVDHAIMIKRCLALFARSNNERLVQKHHLLVKSFESTFEAEIAMFAPPQPAASQEGALSPSAAFRGS
LPPTEHNLARQSMTSPAHGSGSDEAATSAQQQQQQQQQQHNSLRQRGARFSFLGSRRHEPEQSPDSQGSATNHRN
SMGKAPAAPGARSQSQDGKPQGRRSSRDSSDVASTKSTTHGDAADDGAKWKRSSVRKRLSRLALGKKTAKAGVVM
GSLDEE*
Coding >OphauB2|1144
ATGCCCTGGCAGCCTCTTCCTAGAATCGCCTTCGCCGTCGCGACATATCCATTTGCCGCCGAGAGTCCGGCCGAA
CTTCCTCTCGAGATTGGCGATGAGCTGTATATCATTGAAGAAACGCCCGAGGGCGATTGGCTTCGCGGCTATCTA
GTCGCTCCTCCGAGCCTGCTGGCGGGTCTCACGTCGGTCAAGGGCCAAACGTTGGAGGCGCGAGTCTTTAGCGGC
ATTTTCCCCCGGAGCTGTGTGGAAGTGCGAGAGCTGCTAGGCGAGTCAGACATTCGACATGGAGCCAACGGAAAC
GGATATGGCGAAGAAGCGGCCAGCGACTCTGCGAAGAGTGGCATCACCTATGACAACTCTCCAACCAAGGAGCAA
TCCAATGACAAGGCAGCCCGATTTTCAGATCCCAGGAAGCCTCTGAGGGAGCTGTGCAATGGAGCTCCGGGCACG
CTGTCCATTCCTGTCAAGCGCGATCCCAATGCGCCACGACCTGCAGCACCAGTCCCCATGCTCAAGATTGGAGAC
GAGAATCCCACCTCGGCTTCTGAGCCGCTCATAGACGAAATTTCCTCTTGTTTGCGCGAATGGCACTCCAAAAAC
CTCCACCAACTGTTGCTCTCTAGAAAATACGCCGAGCTGGACCAGCTATCACAAGTCATCAATCGGCTCAATCTC
AGCCGTCAGCAGTTTCTATACAATGTTCTCACTGGACGCGAGTATGAGCACCTGCGAGAGCGGACAGTCTGGGAC
CTGGTCAATGTCAACAAGAAGTGTGGTGGCGAGGTAATTGTGCGTGATCCAGCCGCTCGTGGTCGAGTCCTGACG
GCGGAGGACTCAGCTGTTGAGATGACCAGACTCCAATCTCTAATGAGCCTTTTGGACGAGCCTCCTCAACCTGTG
GCCGAGCTATCAAGTCTTCATCATATATTGCTCGAGGTCAAGGGATTCGCAGGATCTTGCAATGAGGAGACTACC
TTGAATCTTTTTCTCGTCAGCAAGCCGAATCATGACAAGGCAACCAACTTGACCGAGTGCTTCAGCGTCAAAATT
CCATCTGGCGGGGCTATCGGGGGTTTGGCGCAAGATTCGTCGACGAGAACCCTCTTTACCGACTTGTCTGGCCAC
GATATTGGTGAAAGCCCTTCTGCAGACTCTTCCATATATCTTGTTGTCAAGGTGCTGTCCTCGCAACAGATTGTC
TCATCAGCGCCGCTTTCTCGCTCTGGCATGGGTGCGGATACTGCCACTTCAAAAGATCAGTACAAGAGCAACTCG
ACTGGCGGTCACCGATCATCAAGGCGGAGTCTCATGTGGGGACGCTCGACATTGTCGCGGGGTCAGACAGCACCG
CGGTTGGACTCGGTGCCAGAGGGCCAGCAAGACTTGTCGACGGCAACTGCATCAGGGAATCGTGACCAGCATATC
CCCCCGAGTACTGCAGGCTCTGCAGCTGATGGGACTGCGACACAAGTACAGATGGTACAGCGGACAGTCGGGATT
GGTGCCCTGAGGCTTAATTCTCTGGTCAAGCAAGACGGTCAAGTTGAAGAGGTCATCAACATCTGGTCGCCAAGT
ACGAGACAGGCTCAGCACAGCAGTGAAGACGAGGAGCTAGATTCACTCATGCGCGAAGTCATGGATAAAGCAAAT
GGGCAGTTTGACAAGTCGCGCAGGGGCGAGCGTTTACAAGTCTGCCTGCAGGCGTTTAACCATGGCGACGCCGAT
GCCTTGATTAGGTGCACGCCAACTTTATTGGCTGGAGTCTCGCAGACGAGCAGGATGGGCTTTTGTGGAGCTCCT
TCGAAGCCTCGATCTGACATTTACTTGACCATCAAGACGGCGGCTCTATCTCGACAGCACCTCTTATCCAGATAT
GGCGGCAGCGCAACAAGCATCACGCCGGGTCTCCAAGGAAACAACTTGCAGGTCAGCGTGGAGGTTCGGGGGCCT
TTGGGCCAAAAGTTGGAAAAGTGCATCTACGCGTCATCTAACCATGAAGGCGTGACAAGGTTCAAGTCGGCCGTT
GCGGAAAGAGGCGAATCTTGGAATCAGACAATACGGCTCTCACTGCAGGCAGACGATGTGCCCACGGCTCACGTG
TTGATTATGGTATCCGAGGTACCGCATGCTCCTTTTGCGGTTGCGCACATGCCGCTTTGGGATCAGCAGGCGTTT
GTGCATGACGAGCGGCATGGACTTTTACTGTACCGGATCGATGAAAACACATCGACTGCCAAAGCTGGGCCTACG
GGCAAGGGGGGCTACTTGTCGTTGCCTTGGGCTCTTCGCGGCAAGGGCCAGCACTCTGCGGAAGTAACTGGGCCT
TTGGCAGTGATTGTGGTGGAATCATTTCTCTGCAGCACGAGGTTTTCTCAAGACAGGGTGATACTTGGTATTCTC
AAGTGGAAGGAGCTGTCACATGAGGACTTGACGTGGGTGCTGCGACAGGTAATGTTTGTGGCTGAAATGGAAGTG
GTCAAGGTGCTGAAGGAGGTGCTGGACGGGCTGTTTGGGGTGATTGCAGAGAATGCTGGCAACGAGGAGCTCGAG
GACCTGGTCTTCACAGCGCTGGTTAGGGTGCTTGACATTGTCCACGACCGGAGGTTTAAGCTGGGCCCCCTGGTT
GAGCAGTACGCGGAGAAGCAGTTCCACTATCCCTACGCGACGTCGAGCTTGATCAGCACGTTTACGCGCTTATTG
GAAAAGCCAGCAGAGCCAGAGACGGCGCGCAAGCTTCGGGCCACGTTCAAGGTGGTGCGGCACATTTTCAAGTTG
ATGTCGCAGGCGCGGGTTCAGATGAGGGAGAAGGAGGCGGTGATTGGCATCACGTCGTCGTCGCAGAGCTTCACG
CGTCAGCTGCGGAGCATTTTCGAGGGGCTGAATGGCATGATGCGCAATTCGGCGGCGGCGCTGGTTGGCAGCCAG
ACACTGGCGGTGCAGCATTTCCACACGTGGCTGCCAGAGCTCAGGGGGCTGCTGAGTGGGGAGGAGATTGTGCAC
ATTGCGATTGACTTTATGGACTCGTGCATGCAGGTCAAGGGCAAGCTGATACTGTACAAGCTGGTGCTCATCATC
AACTACTCCAAGCTGGAGCTGTTTGGGCAGGGCGAGCAGGCGGCGGCGCTGTGTGCCAACACTGTGCGGTGGATA
GCGCCGCACTGGGGGGCTACGGAGGAGGTTGACGAGCAGTGGCGGAGCCAGGTGCGGCTGTGCTGCTCCGTGGTG
GCCAGCCAGGTGAAGCACCTGGGGGCAGAGATACCGGACCACCTGGGCAAGATTGTTGATTCCTATCTCGGGCTG
GTGGGGCGTGGGCACAAGGGGCGGGAGCGGGAGCGGGAGCGGGGGCGGGTGTCGCTGCTCTTCCCGACGAGCTAT
CCCTTTCCCAGCAAGGCGACGCGGCAAAGGCTGGAGCAGGACGAGGCGCTGGCGGAGCTGGCGGCGGTGCTGGCG
GCGGTGTCGAGCAGCCGGGGTGGGATGCAGCTGGAGCTGGCAGAGGGCGACCTGACGGTGCTGGTGGAGAAGCTG
CTGCGGGTGCATCTGAGCATTCTGGAGGGCGAGGCCTTTCCGGCAGGCTGGCTGAGCGTGCAAATGTACCACGCC
AAGTGGAGCATGGCGACTCTGCAGTACCTGGCGGACATTATGCTGGCGTCGTTTGTGCCCGAGGCGGAGGAGGCG
GAGAGCTTCAAGACGGAGCTGTGGAAGCTGCTGCTGACGACGCTGGTCAAGCTGGTGGCGAGCGAGAAGCTGGCG
CTGGAGACGTTTGCGGAGCAGAAGCGGCGGGCGGTGTGGAAGATTGCGGGCGACGTGCGCGAGCAGGGCGCGGAG
CTGCTGCGCAAGACGTGGGAGGCGATTGGGTGGGAGGCGAGCAGCGAGGAACAAGAAAGCTACGGGCTGGAGCGG
ATTGGCGGCTACCAGGTGCAGTATGTGCCGACGCTGGTGGGCCCCATTGTCGAGCTGTGCCTCAGCGTGCACGAG
GGCCTGCGGCGCACGGCAGTTCAGGTGCTGCAGACCATGATTGTCAGCGAGTGGGCGCTGAGCCAGGACCTGAGC
GCGGTGCAGACGGAGATGGTGGACTGCCTGGACCACATCTTCAAGACGCGGCCGCTGACGGAGAGCATGCTGCAG
AAGCTCTTTGTGGCGGAGCTGCTGCAGCGCTTTGAGCGTCTGGCGGCCGACGAGGCGCTCTATCCCGCCATGCAG
CAGCTGGTGGCGCGGGTGGACGAGTTTGTCGACCTGCTGGTGGCGGTGCACTCGAGCCACGAGGCCGACGACGTG
TCCACCATTATCAACCGCCTGCGCCTCATGGAGTTTCTGCGCGACATGCAAAAGGAGGACATCTTCATCCGCTAC
GTCCATCAGCTGGCGCGCTCTCAGGCCCAGGCCGGCAACCAGGCCGAGGCGGGCTTGGCCCTGCGCCTCCACGCC
GACCTGTACGACTGGGAGCCGCTCAAGCAGACGCCTGCCCTGGCCGACCCCTGCCTGCCCGCCCAGTCCATGTTT
GAGCGCAAGGAGCTGCTCTACTTTGACATGATTAAGCACTTTGAGGAGGGAGAGTCGTGGAGCAATGCCCTGACG
GCCTACAAGGAGCTGCAGACGCAGTACGAGGCCAATGTCTTTGACTTTGCCAAGCTTGCCCGCACCCAGCGCGCC
ATTGCCACCATTTACCATGACCTGACAGCCAGCCACGCAATCCTGCCGCCCTACTTCAAGGTGGTCTACAAGGGC
CTCGGCTTCCCCCCGACCCTCCGCGACAAGGGCTTCATCTACCAGGGCTCCCTGGCCGAGCGCCCCGACGCCTTT
GCCGACCGCATGCAGGAGCAGTATCCCTCAGCCCACATCATCACTGCCGCCCACACCGACGAGGTTGAGGGCCAG
TATCTCCTCGTCTCCGCCTTGACGCCCCTTCGCGACTGGTCCCACCCCGTCTACCAGCGCCCCCGAGTGCCCCCC
GAGGCCCGAGACTTCTTGCTCTGCTCCCATCCCCAGGCCTTTTCCTTTACCACCCAGCGCCACACTGTCGGCCCT
GTCCACCAGCACTATGCCCAAAAGCTCGTCTTTTGCACTGCAGAACCCTTTCCCACGCTTTTGCGCCGAAGCGAG
ATTGTCGACATGTACCCGCTGAGCCTCGATGCCCGCCAAACCGCCCTGGAGCGCATTGTCCGCAAGACGTACGAG
ATGACGGCTCTCGAGCGCCGCCTGGCCGCTGGAAACGACCAAGACGCTCAGCTGCTCCTCGATGCTGTATCCGTT
TCGCTCAATGCCGCCTCGGAGCACAGCGTTGTCTGCTACCGCAAGCTGCTGCCCGAGTCCCAACCACCCGATGCC
GATGCCGACGCCGACGACGACGACGACGACGACGACGACGACGACGACGAGCAGCAGCCGCCCGAGCTGGAGCCT
AGAGATGTAGCCGTCAAGATGGCCCTAGTTGACCATGCAATCATGATTAAACGCTGTCTCGCGCTCTTTGCTCGA
AGCAACAACGAGAGGCTTGTCCAGAAGCATCACCTTCTCGTCAAATCTTTTGAGAGCACCTTTGAAGCCGAGATT
GCCATGTTTGCTCCCCCTCAGCCCGCAGCATCCCAAGAGGGCGCTCTGAGTCCGTCAGCGGCGTTTAGAGGCTCG
CTGCCTCCGACTGAGCATAATCTGGCGCGGCAAAGCATGACGAGCCCCGCCCATGGCTCGGGCAGCGACGAGGCA
GCGACGAGTGCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAACACAATTCCCTCCGCCAACGAGGCGCCAGGTTC
AGCTTTCTAGGCAGCCGCAGACACGAACCCGAGCAGTCCCCCGATTCCCAAGGCAGCGCGACAAACCATCGAAAT
AGCATGGGCAAGGCGCCCGCTGCACCCGGCGCCCGCTCGCAGTCGCAGGATGGAAAGCCACAGGGTAGACGTAGT
AGTAGGGACAGCTCCGACGTGGCCTCGACCAAGAGTACGACGCATGGGGACGCGGCCGACGATGGCGCCAAGTGG
AAGCGCTCCAGCGTGCGCAAGCGACTAAGTCGCCTCGCCCTGGGCAAGAAGACTGCCAAGGCAGGCGTCGTCATG
GGCAGTCTGGACGAAGAGTGA
Transcript >OphauB2|1144
ATGCCCTGGCAGCCTCTTCCTAGAATCGCCTTCGCCGTCGCGACATATCCATTTGCCGCCGAGAGTCCGGCCGAA
CTTCCTCTCGAGATTGGCGATGAGCTGTATATCATTGAAGAAACGCCCGAGGGCGATTGGCTTCGCGGCTATCTA
GTCGCTCCTCCGAGCCTGCTGGCGGGTCTCACGTCGGTCAAGGGCCAAACGTTGGAGGCGCGAGTCTTTAGCGGC
ATTTTCCCCCGGAGCTGTGTGGAAGTGCGAGAGCTGCTAGGCGAGTCAGACATTCGACATGGAGCCAACGGAAAC
GGATATGGCGAAGAAGCGGCCAGCGACTCTGCGAAGAGTGGCATCACCTATGACAACTCTCCAACCAAGGAGCAA
TCCAATGACAAGGCAGCCCGATTTTCAGATCCCAGGAAGCCTCTGAGGGAGCTGTGCAATGGAGCTCCGGGCACG
CTGTCCATTCCTGTCAAGCGCGATCCCAATGCGCCACGACCTGCAGCACCAGTCCCCATGCTCAAGATTGGAGAC
GAGAATCCCACCTCGGCTTCTGAGCCGCTCATAGACGAAATTTCCTCTTGTTTGCGCGAATGGCACTCCAAAAAC
CTCCACCAACTGTTGCTCTCTAGAAAATACGCCGAGCTGGACCAGCTATCACAAGTCATCAATCGGCTCAATCTC
AGCCGTCAGCAGTTTCTATACAATGTTCTCACTGGACGCGAGTATGAGCACCTGCGAGAGCGGACAGTCTGGGAC
CTGGTCAATGTCAACAAGAAGTGTGGTGGCGAGGTAATTGTGCGTGATCCAGCCGCTCGTGGTCGAGTCCTGACG
GCGGAGGACTCAGCTGTTGAGATGACCAGACTCCAATCTCTAATGAGCCTTTTGGACGAGCCTCCTCAACCTGTG
GCCGAGCTATCAAGTCTTCATCATATATTGCTCGAGGTCAAGGGATTCGCAGGATCTTGCAATGAGGAGACTACC
TTGAATCTTTTTCTCGTCAGCAAGCCGAATCATGACAAGGCAACCAACTTGACCGAGTGCTTCAGCGTCAAAATT
CCATCTGGCGGGGCTATCGGGGGTTTGGCGCAAGATTCGTCGACGAGAACCCTCTTTACCGACTTGTCTGGCCAC
GATATTGGTGAAAGCCCTTCTGCAGACTCTTCCATATATCTTGTTGTCAAGGTGCTGTCCTCGCAACAGATTGTC
TCATCAGCGCCGCTTTCTCGCTCTGGCATGGGTGCGGATACTGCCACTTCAAAAGATCAGTACAAGAGCAACTCG
ACTGGCGGTCACCGATCATCAAGGCGGAGTCTCATGTGGGGACGCTCGACATTGTCGCGGGGTCAGACAGCACCG
CGGTTGGACTCGGTGCCAGAGGGCCAGCAAGACTTGTCGACGGCAACTGCATCAGGGAATCGTGACCAGCATATC
CCCCCGAGTACTGCAGGCTCTGCAGCTGATGGGACTGCGACACAAGTACAGATGGTACAGCGGACAGTCGGGATT
GGTGCCCTGAGGCTTAATTCTCTGGTCAAGCAAGACGGTCAAGTTGAAGAGGTCATCAACATCTGGTCGCCAAGT
ACGAGACAGGCTCAGCACAGCAGTGAAGACGAGGAGCTAGATTCACTCATGCGCGAAGTCATGGATAAAGCAAAT
GGGCAGTTTGACAAGTCGCGCAGGGGCGAGCGTTTACAAGTCTGCCTGCAGGCGTTTAACCATGGCGACGCCGAT
GCCTTGATTAGGTGCACGCCAACTTTATTGGCTGGAGTCTCGCAGACGAGCAGGATGGGCTTTTGTGGAGCTCCT
TCGAAGCCTCGATCTGACATTTACTTGACCATCAAGACGGCGGCTCTATCTCGACAGCACCTCTTATCCAGATAT
GGCGGCAGCGCAACAAGCATCACGCCGGGTCTCCAAGGAAACAACTTGCAGGTCAGCGTGGAGGTTCGGGGGCCT
TTGGGCCAAAAGTTGGAAAAGTGCATCTACGCGTCATCTAACCATGAAGGCGTGACAAGGTTCAAGTCGGCCGTT
GCGGAAAGAGGCGAATCTTGGAATCAGACAATACGGCTCTCACTGCAGGCAGACGATGTGCCCACGGCTCACGTG
TTGATTATGGTATCCGAGGTACCGCATGCTCCTTTTGCGGTTGCGCACATGCCGCTTTGGGATCAGCAGGCGTTT
GTGCATGACGAGCGGCATGGACTTTTACTGTACCGGATCGATGAAAACACATCGACTGCCAAAGCTGGGCCTACG
GGCAAGGGGGGCTACTTGTCGTTGCCTTGGGCTCTTCGCGGCAAGGGCCAGCACTCTGCGGAAGTAACTGGGCCT
TTGGCAGTGATTGTGGTGGAATCATTTCTCTGCAGCACGAGGTTTTCTCAAGACAGGGTGATACTTGGTATTCTC
AAGTGGAAGGAGCTGTCACATGAGGACTTGACGTGGGTGCTGCGACAGGTAATGTTTGTGGCTGAAATGGAAGTG
GTCAAGGTGCTGAAGGAGGTGCTGGACGGGCTGTTTGGGGTGATTGCAGAGAATGCTGGCAACGAGGAGCTCGAG
GACCTGGTCTTCACAGCGCTGGTTAGGGTGCTTGACATTGTCCACGACCGGAGGTTTAAGCTGGGCCCCCTGGTT
GAGCAGTACGCGGAGAAGCAGTTCCACTATCCCTACGCGACGTCGAGCTTGATCAGCACGTTTACGCGCTTATTG
GAAAAGCCAGCAGAGCCAGAGACGGCGCGCAAGCTTCGGGCCACGTTCAAGGTGGTGCGGCACATTTTCAAGTTG
ATGTCGCAGGCGCGGGTTCAGATGAGGGAGAAGGAGGCGGTGATTGGCATCACGTCGTCGTCGCAGAGCTTCACG
CGTCAGCTGCGGAGCATTTTCGAGGGGCTGAATGGCATGATGCGCAATTCGGCGGCGGCGCTGGTTGGCAGCCAG
ACACTGGCGGTGCAGCATTTCCACACGTGGCTGCCAGAGCTCAGGGGGCTGCTGAGTGGGGAGGAGATTGTGCAC
ATTGCGATTGACTTTATGGACTCGTGCATGCAGGTCAAGGGCAAGCTGATACTGTACAAGCTGGTGCTCATCATC
AACTACTCCAAGCTGGAGCTGTTTGGGCAGGGCGAGCAGGCGGCGGCGCTGTGTGCCAACACTGTGCGGTGGATA
GCGCCGCACTGGGGGGCTACGGAGGAGGTTGACGAGCAGTGGCGGAGCCAGGTGCGGCTGTGCTGCTCCGTGGTG
GCCAGCCAGGTGAAGCACCTGGGGGCAGAGATACCGGACCACCTGGGCAAGATTGTTGATTCCTATCTCGGGCTG
GTGGGGCGTGGGCACAAGGGGCGGGAGCGGGAGCGGGAGCGGGGGCGGGTGTCGCTGCTCTTCCCGACGAGCTAT
CCCTTTCCCAGCAAGGCGACGCGGCAAAGGCTGGAGCAGGACGAGGCGCTGGCGGAGCTGGCGGCGGTGCTGGCG
GCGGTGTCGAGCAGCCGGGGTGGGATGCAGCTGGAGCTGGCAGAGGGCGACCTGACGGTGCTGGTGGAGAAGCTG
CTGCGGGTGCATCTGAGCATTCTGGAGGGCGAGGCCTTTCCGGCAGGCTGGCTGAGCGTGCAAATGTACCACGCC
AAGTGGAGCATGGCGACTCTGCAGTACCTGGCGGACATTATGCTGGCGTCGTTTGTGCCCGAGGCGGAGGAGGCG
GAGAGCTTCAAGACGGAGCTGTGGAAGCTGCTGCTGACGACGCTGGTCAAGCTGGTGGCGAGCGAGAAGCTGGCG
CTGGAGACGTTTGCGGAGCAGAAGCGGCGGGCGGTGTGGAAGATTGCGGGCGACGTGCGCGAGCAGGGCGCGGAG
CTGCTGCGCAAGACGTGGGAGGCGATTGGGTGGGAGGCGAGCAGCGAGGAACAAGAAAGCTACGGGCTGGAGCGG
ATTGGCGGCTACCAGGTGCAGTATGTGCCGACGCTGGTGGGCCCCATTGTCGAGCTGTGCCTCAGCGTGCACGAG
GGCCTGCGGCGCACGGCAGTTCAGGTGCTGCAGACCATGATTGTCAGCGAGTGGGCGCTGAGCCAGGACCTGAGC
GCGGTGCAGACGGAGATGGTGGACTGCCTGGACCACATCTTCAAGACGCGGCCGCTGACGGAGAGCATGCTGCAG
AAGCTCTTTGTGGCGGAGCTGCTGCAGCGCTTTGAGCGTCTGGCGGCCGACGAGGCGCTCTATCCCGCCATGCAG
CAGCTGGTGGCGCGGGTGGACGAGTTTGTCGACCTGCTGGTGGCGGTGCACTCGAGCCACGAGGCCGACGACGTG
TCCACCATTATCAACCGCCTGCGCCTCATGGAGTTTCTGCGCGACATGCAAAAGGAGGACATCTTCATCCGCTAC
GTCCATCAGCTGGCGCGCTCTCAGGCCCAGGCCGGCAACCAGGCCGAGGCGGGCTTGGCCCTGCGCCTCCACGCC
GACCTGTACGACTGGGAGCCGCTCAAGCAGACGCCTGCCCTGGCCGACCCCTGCCTGCCCGCCCAGTCCATGTTT
GAGCGCAAGGAGCTGCTCTACTTTGACATGATTAAGCACTTTGAGGAGGGAGAGTCGTGGAGCAATGCCCTGACG
GCCTACAAGGAGCTGCAGACGCAGTACGAGGCCAATGTCTTTGACTTTGCCAAGCTTGCCCGCACCCAGCGCGCC
ATTGCCACCATTTACCATGACCTGACAGCCAGCCACGCAATCCTGCCGCCCTACTTCAAGGTGGTCTACAAGGGC
CTCGGCTTCCCCCCGACCCTCCGCGACAAGGGCTTCATCTACCAGGGCTCCCTGGCCGAGCGCCCCGACGCCTTT
GCCGACCGCATGCAGGAGCAGTATCCCTCAGCCCACATCATCACTGCCGCCCACACCGACGAGGTTGAGGGCCAG
TATCTCCTCGTCTCCGCCTTGACGCCCCTTCGCGACTGGTCCCACCCCGTCTACCAGCGCCCCCGAGTGCCCCCC
GAGGCCCGAGACTTCTTGCTCTGCTCCCATCCCCAGGCCTTTTCCTTTACCACCCAGCGCCACACTGTCGGCCCT
GTCCACCAGCACTATGCCCAAAAGCTCGTCTTTTGCACTGCAGAACCCTTTCCCACGCTTTTGCGCCGAAGCGAG
ATTGTCGACATGTACCCGCTGAGCCTCGATGCCCGCCAAACCGCCCTGGAGCGCATTGTCCGCAAGACGTACGAG
ATGACGGCTCTCGAGCGCCGCCTGGCCGCTGGAAACGACCAAGACGCTCAGCTGCTCCTCGATGCTGTATCCGTT
TCGCTCAATGCCGCCTCGGAGCACAGCGTTGTCTGCTACCGCAAGCTGCTGCCCGAGTCCCAACCACCCGATGCC
GATGCCGACGCCGACGACGACGACGACGACGACGACGACGACGACGACGAGCAGCAGCCGCCCGAGCTGGAGCCT
AGAGATGTAGCCGTCAAGATGGCCCTAGTTGACCATGCAATCATGATTAAACGCTGTCTCGCGCTCTTTGCTCGA
AGCAACAACGAGAGGCTTGTCCAGAAGCATCACCTTCTCGTCAAATCTTTTGAGAGCACCTTTGAAGCCGAGATT
GCCATGTTTGCTCCCCCTCAGCCCGCAGCATCCCAAGAGGGCGCTCTGAGTCCGTCAGCGGCGTTTAGAGGCTCG
CTGCCTCCGACTGAGCATAATCTGGCGCGGCAAAGCATGACGAGCCCCGCCCATGGCTCGGGCAGCGACGAGGCA
GCGACGAGTGCACAGCAGCAGCAGCAGCAGCAGCAGCAGCAACACAATTCCCTCCGCCAACGAGGCGCCAGGTTC
AGCTTTCTAGGCAGCCGCAGACACGAACCCGAGCAGTCCCCCGATTCCCAAGGCAGCGCGACAAACCATCGAAAT
AGCATGGGCAAGGCGCCCGCTGCACCCGGCGCCCGCTCGCAGTCGCAGGATGGAAAGCCACAGGGTAGACGTAGT
AGTAGGGACAGCTCCGACGTGGCCTCGACCAAGAGTACGACGCATGGGGACGCGGCCGACGATGGCGCCAAGTGG
AAGCGCTCCAGCGTGCGCAAGCGACTAAGTCGCCTCGCCCTGGGCAAGAAGACTGCCAAGGCAGGCGTCGTCATG
GGCAGTCTGGACGAAGAGTGA
Gene >OphauB2|1144
ATGCCCTGGCAGCCTCTTCCTAGAATCGCCTTCGCCGTCGCGACATATCCATTTGCCGCCGAGAGTCCGGCCGAA
CTTCCTCTCGAGATTGGCGATGAGCTGTATATCATTGAAGAAACGCCCGAGGGCGATTGGCTTCGCGGCTATCTA
GTCGCTCCTCCGAGCCTGCTGGCGGGTCTCACGTCGGTCAAGGGCCAAACGTTGGAGGCGCGAGTCTTTAGCGGC
ATTTTCCCCCGGAGCTGTGTGGAAGTGCGAGAGCTGCTAGGCGAGTCAGACATTCGACATGGAGCCAACGGAAAC
GGATATGGCGAAGAAGCGGCCAGCGACTCTGCGAAGAGTGGCATCACCTATGACAACTCTCCAACCAAGGAGCAA
TCCAATGACAAGGCAGCCCGATTTTCAGATCCCAGGAAGCCTCTGAGGGAGCTGTGCAATGGAGCTCCGGGCACG
CTGTCCATTCCTGTCAAGCGCGATCCCAATGCGCCACGACCTGCAGCACCAGTCCCCATGCTCAAGATTGGAGAC
GAGAATCCCACCTCGGCTTCTGAGCCGCTCATAGACGAAATTTCCTCTTGTTTGCGCGAATGGCACTCCAAAAAC
CTCCACCAACTGTTGCTCTCTAGAAAATACGCCGAGCTGGACCAGCTATCACAAGTCATCAATCGGCTCAATCTC
AGCCGTCAGCAGTTTCTATACAATGTTCTCACTGGACGCGAGTATGAGCACCTGCGAGAGCGGACAGTCTGGGAC
CTGGTCAATGTCAACAAGAAGTGTGGTGGCGAGGTAATTGTGCGTGATCCAGCCGCTCGTGGTCGAGTCCTGACG
GCGGAGGACTCAGCTGTTGAGATGACCAGACTCCAATCTCTAATGAGCCTTTTGGACGAGCCTCCTCAACCTGTG
GCCGAGCTATCAAGTCTTCATCATATATTGCTCGAGGTCAAGGGATTCGCAGGATCTTGCAATGAGGAGACTACC
TTGAATCTTTTTCTCGTCAGCAAGCCGAATCATGACAAGGCAACCAACTTGACCGAGTGCTTCAGCGTCAAAATT
CCATCTGGCGGGGCTATCGGGGGTTTGGCGCAAGATTCGTCGACGAGAACCCTCTTTACCGACTTGTCTGGCCAC
GATATTGGTGAAAGCCCTTCTGCAGACTCTTCCATATATCTTGTTGTCAAGGTGCTGTCCTCGCAACAGATTGTC
TCATCAGCGCCGCTTTCTCGCTCTGGCATGGGTGCGGATACTGCCACTTCAAAAGATCAGTACAAGAGCAACTCG
ACTGGCGGTCACCGATCATCAAGGCGGAGTCTCATGTGGGGACGCTCGACATTGTCGCGGGGTCAGACAGCACCG
CGGTTGGACTCGGTGCCAGAGGGCCAGCAAGACTTGTCGACGGCAACTGCATCAGGGAATCGTGACCAGCATATC
CCCCCGAGTACTGCAGGCTCTGCAGCTGATGGGACTGCGACACAAGTACAGATGGTACAGCGGACAGTCGGGATT
GGTGCCCTGAGGCTTAATTCTCTGGTCAAGCAAGACGGTCAAGTTGAAGAGGTCATCAACATCTGGTCGCCAAGT
ACGAGACAGGCTCAGCACAGCAGTGAAGACGAGGAGCTAGATTCACTCATGCGCGAAGTCATGGATAAAGCAAAT
GGGCAGTTTGACAAGTCGCGCAGGGGCGAGCGTTTACAAGTCTGCCTGCAGGCGTTTAACCATGGCGACGCCGAT
GCCTTGATTAGGTGCACGCCAACTTTATTGGCTGGAGTCTCGCAGACGAGCAGGATGGGCTTTTGTGGAGCTCCT
TCGAAGCCTCGATCTGACATTTACTTGACCATCAAGACGGCGGCTCTATCTCGACAGCACCTCTTATCCAGATAT
GGCGGCAGCGCAACAAGCATCACGCCGGGTCTCCAAGGAAACAACTTGCAGGTCAGCGTGGAGGTTCGGGGGCCT
TTGGGCCAAAAGTTGGAAAAGTGCATCTACGCGTCATCTAACCATGAAGGCGTGACAAGGTTCAAGTCGGCCGTT
GCGGAAAGAGGCGAATCTTGGAATCAGACAATACGGCTCTCACTGCAGGCAGACGATGTGCCCACGGCTCACGTG
TTGATTATGGTATCCGAGGTACCGCATGCTCCTTTTGCGGTTGCGCACATGCCGCTTTGGGATCAGCAGGCGTTT
GTGCATGACGAGCGGCATGGACTTTTACTGTACCGGATCGATGAAAACACATCGACTGCCAAAGCTGGGCCTACG
GGCAAGGGGGGCTACTTGTCGTTGCCTTGGGCTCTTCGCGGCAAGGGCCAGCACTCTGCGGAAGTAACTGGGCCT
TTGGCAGTGATTGTGGTGGAATCATTTCTCTGCAGCACGAGGTTTTCTCAAGACAGGGTGATACTTGGTATTCTC
AAGTGGAAGGAGCTGTCACATGAGGACTTGACGTGGGTGCTGCGACAGGTAATGTTTGTGGCTGAAATGGAAGTG
GTCAAGGTGCTGAAGGAGGTGCTGGACGGGCTGTTTGGGGTGATTGCAGAGAATGCTGGCAACGAGGAGCTCGAG
GACCTGGTCTTCACAGCGCTGGTTAGGGTGCTTGACATTGTCCACGACCGGAGGTTTAAGCTGGGCCCCCTGGTT
GAGCAGTACGCGGAGAAGCAGTTCCACTATCCCTACGCGACGTCGAGCTTGATCAGCACGTTTACGCGCTTATTG
GAAAAGCCAGCAGAGCCAGAGACGGCGCGCAAGCTTCGGGCCACGTTCAAGGTGGTGCGGCACATTTTCAAGTTG
ATGTCGCAGGCGCGGGTTCAGATGAGGGAGAAGGAGGCGGTGATTGGCATCACGTCGTCGTCGCAGAGCTTCACG
CGTCAGCTGCGGAGCATTTTCGAGGGGCTGAATGGCATGATGCGCAATTCGGCGGCGGCGCTGGTTGGCAGCCAG
ACACTGGCGGTGCAGCATTTCCACACGTGGCTGCCAGAGCTCAGGGGGCTGCTGAGTGGGGAGGAGATTGTGCAC
ATTGCGATTGACTTTATGGACTCGTGCATGCAGGTCAAGGGCAAGCTGATACTGTACAAGCTGGTGCTCATCATC
AACTACTCCAAGCTGGAGCTGTTTGGGCAGGGCGAGCAGGCGGCGGCGCTGTGTGCCAACACTGTGCGGTGGATA
GCGCCGCACTGGGGGGCTACGGAGGAGGTTGACGAGCAGTGGCGGAGCCAGGTGCGGCTGTGCTGCTCCGTGGTG
GCCAGCCAGGTGAAGCACCTGGGGGCAGAGATACCGGACCACCTGGGCAAGATTGTTGATTCCTATCTCGGGCTG
GTGGGGCGTGGGCACAAGGGGCGGGAGCGGGAGCGGGAGCGGGGGCGGGTGTCGCTGCTCTTCCCGACGAGCTAT
CCCTTTCCCAGCAAGGCGACGCGGCAAAGGCTGGAGCAGGACGAGGCGCTGGCGGAGCTGGCGGCGGTGCTGGCG
GCGGTGTCGAGCAGCCGGGGTGGGATGCAGCTGGAGCTGGCAGAGGGCGACCTGACGGTGCTGGTGGAGAAGCTG
CTGCGGGTGCATCTGAGCATTCTGGAGGGCGAGGCCTTTCCGGCAGGCTGGCTGAGCGTGCAAATGTACCACGCC
AAGTGGAGCATGGCGACTCTGCAGTACCTGGCGGACATTATGCTGGCGTCGTTTGTGCCCGAGGCGGAGGAGGCG
GAGAGCTTCAAGACGGAGCTGTGGAAGCTGCTGCTGACGACGCTGGTCAAGCTGGTGGCGAGCGAGAAGCTGGCG
CTGGAGACGTTTGCGGAGCAGAAGCGGCGGGCGGTGTGGAAGATTGCGGGCGACGTGCGCGAGCAGGGCGCGGAG
CTGCTGCGCAAGACGTGGGAGGCGATTGGGTGGGAGGCGAGCAGCGAGGAACAAGAAAGCTACGGGCTGGAGCGG
ATTGGCGGCTACCAGGTGCAGTATGTGCCGACGCTGGTGGGCCCCATTGTCGAGCTGTGCCTCAGCGTGCACGAG
GGCCTGCGGCGCACGGCAGTTCAGGTGCTGCAGACCATGATTGTCAGCGAGTGGGCGCTGAGCCAGGACCTGAGC
GCGGTGCAGACGGAGATGGTGGACTGCCTGGACCACATCTTCAAGACGCGGCCGCTGACGGAGAGCATGCTGCAG
AAGCTCTTTGTGGCGGAGCTGCTGCAGCGCTTTGAGCGTCTGGCGGCCGACGAGGCGCTCTATCCCGCCATGCAG
CAGCTGGTGGCGCGGGTGGACGAGTTTGTCGACCTGCTGGTGGCGGTGCACTCGAGCCACGAGGCCGACGACGTG
TCCACCATTATCAACCGCCTGCGCCTCATGGAGTTTCTGCGCGACATGCAAAAGGAGGACATCTTCATCCGCTAC
GTCCATCAGCTGGCGCGCTCTCAGGCCCAGGCCGGCAACCAGGCCGAGGCGGGCTTGGCCCTGCGCCTCCACGCC
GACCTGTACGACTGGGAGCCGCTCAAGCAGACGCCTGCCCTGGCCGACCCCTGCCTGCCCGCCCAGTCCATGTTT
GAGCGCAAGGAGCTGCTCTACTTTGACATGATTAAGCACTTTGAGGAGGGAGAGTCGTGGAGCAATGCCCTGACG
GCCTACAAGGAGCTGCAGACGCAGTACGAGGCCAATGTCTTTGACTTTGCCAAGCTTGCCCGCACCCAGCGCGCC
ATTGCCACCATTTACCATGACCTGACAGCCAGCCACGCAATCCTGCCGCCCTACTTCAAGGTGGTCTACAAGGGC
CTCGGCTTCCCCCCGACCCTCCGCGACAAGGGCTTCATCTACCAGGGCTCCCTGGCCGAGCGCCCCGACGCCTTT
GCCGACCGCATGCAGGAGCAGTATCCCTCAGCCCACATCATCACTGCCGCCCACACCGACGAGGTTGAGGGCCAG
TATCTCCTCGTCTCCGCCTTGACGCCCCTTCGCGACTGGTCCCACCCCGTCTACCAGCGCCCCCGAGTGCCCCCC
GAGGCCCGAGACTTCTTGCTCTGCTCCCATCCCCAGGCCTTTTCCTTTACCACCCAGCGCCACACTGTCGGCCCT
GTCCACCAGCACTATGCCCAAAAGCTCGTCTTTTGCACTGCAGAACCCTTTCCCACGCTTTTGCGCCGAAGCGAG
ATTGTCGACATGTACCCGCTGAGCCTCGATGCCCGCCAAACCGCCCTGGAGCGCATTGTCCGCAAGACGTACGAG
ATGACGGCTCTCGAGCGCCGCCTGGCCGCTGGAAACGACCAAGACGCTCAGCTGCTCCTCGATGCTGTATCCGTT
TCGCTCAATGCCGCCTCGGAGCACAGCGTTGTCTGCTACCGCAAGCTGCTGCCCGAGTCCCAACCACCCGATGCC
GATGCCGACGCCGACGACGACGACGACGACGACGACGACGACGACGACGAGCAGCAGCCGCCCGAGCTGGAGCCT
AGAGATGTAGCCGTCAAGATGGCCCTAGTTGACCATGCAATCATGATTAAACGCTGTCTCGCGCTCTTTGCTCGA
AGCAACAACGAGAGGCTTGTCCAGAAGCATCACCTTCTCGTCAAATGTACGTTGCCTTGCTGCCTGACACGCTGC
CCCTGATGCCGCAGGACTAATCATGAGACACAGCTTTTGAGAGCACCTTTGAAGCCGAGATTGCCATGTTTGCTC
CCCCTCAGCCCGCAGCATCCCAAGAGGGCGCTCTGAGTCCGTCAGCGGCGTTTAGAGGCTCGCTGCCTCCGACTG
AGCATAATCTGGCGCGGCAAAGCATGACGAGCCCCGCCCATGGCTCGGGCAGCGACGAGGCAGCGACGAGTGCAC
AGCAGCAGCAGCAGCAGCAGCAGCAGCAACACAATTCCCTCCGCCAACGAGGCGCCAGGTTCAGCTTTCTAGGCA
GCCGCAGACACGAACCCGAGCAGTCCCCCGATTCCCAAGGCAGCGCGACAAACCATCGAAATAGCATGGGCAAGG
CGCCCGCTGCACCCGGCGCCCGCTCGCAGTCGCAGGATGGAAAGCCACAGGGTAGACGTAGTAGTAGGGACAGCT
CCGACGTGGCCTCGACCAAGAGTACGACGCATGGGGACGCGGCCGACGATGGCGCCAAGTGGAAGCGCTCCAGCG
TGCGCAAGCGACTAAGTCGCCTCGCCCTGGGCAAGAAGACTGCCAAGGCAGGCGTCGTCATGGGCAGTCTGGACG
AAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail