Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1139
Gene name
LocationContig_128:3288..3754
Strand-
Gene length (bp)466
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09415 CENP-X CENP-S associating Centromere protein X 6.6E-22 67 133

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8C4X1|CENPX_MOUSE Centromere protein X OS=Mus musculus GN=Stra13 PE=2 SV=1 60 133 4.0E-07

GO

GO Term Description Terminal node
GO:0051382 kinetochore assembly Yes
GO:0006281 DNA repair Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0070925 organelle assembly No
GO:0090304 nucleic acid metabolic process No
GO:0140694 non-membrane-bounded organelle assembly No
GO:1901360 organic cyclic compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0051276 chromosome organization No
GO:0043933 protein-containing complex organization No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0044238 primary metabolic process No
GO:0022607 cellular component assembly No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No
GO:0051383 kinetochore organization No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1139
MPPKRGSSGGARGSSKGKKSKRPAPTPESSNRFDSTNEATGAIVKDTVARRASSSLKPSEPEKSIPKQLLTRLLH
EMFAKEATRISRDANAAAGKYLDVFVREAIARAAVDKIGDFLEVEDLERIAPQLLLDL*
Coding >OphauB2|1139
ATGCCGCCGAAACGAGGCTCGTCTGGGGGTGCGCGTGGAAGTTCCAAGGGCAAAAAGAGCAAGCGCCCCGCGCCA
ACGCCCGAATCGAGCAATCGATTTGACTCGACAAACGAGGCAACGGGTGCGATAGTGAAGGATACAGTGGCACGA
AGGGCCAGCAGTTCATTGAAGCCTTCAGAGCCGGAAAAGTCAATACCCAAGCAGTTGCTAACGCGGTTGCTACAC
GAGATGTTTGCCAAGGAGGCAACGAGGATTTCACGCGATGCCAACGCAGCCGCAGGGAAATATCTCGACGTGTTT
GTGCGCGAAGCTATTGCGAGAGCTGCAGTGGACAAGATTGGCGATTTCTTGGAGGTTGAGGACCTCGAGAGGATT
GCACCCCAGCTCTTGCTTGATTTATAG
Transcript >OphauB2|1139
ATGCCGCCGAAACGAGGCTCGTCTGGGGGTGCGCGTGGAAGTTCCAAGGGCAAAAAGAGCAAGCGCCCCGCGCCA
ACGCCCGAATCGAGCAATCGATTTGACTCGACAAACGAGGCAACGGGTGCGATAGTGAAGGATACAGTGGCACGA
AGGGCCAGCAGTTCATTGAAGCCTTCAGAGCCGGAAAAGTCAATACCCAAGCAGTTGCTAACGCGGTTGCTACAC
GAGATGTTTGCCAAGGAGGCAACGAGGATTTCACGCGATGCCAACGCAGCCGCAGGGAAATATCTCGACGTGTTT
GTGCGCGAAGCTATTGCGAGAGCTGCAGTGGACAAGATTGGCGATTTCTTGGAGGTTGAGGACCTCGAGAGGATT
GCACCCCAGCTCTTGCTTGATTTATAG
Gene >OphauB2|1139
ATGCCGCCGAAACGAGGCTCGTCTGGGGGTGCGCGTGGAAGTTCCAAGGGCAAAAAGAGCAAGCGCCCCGCGCCA
ACGCCCGAATCGAGCAATCGATTTGACTCGACAAACGAGGCAACGGGTGCGATAGTGAAGGATACAGTGGCACGA
AGGGCCAGCAGTTCATTGAAGCCTTCAGAGCCGGAAAAGTCAATACCCAAGCAGTTGCTAACGCGGTTGCTACAC
GAGATGTTTGCCAAGGAGGCAACGAGGATTTCACGCGATGCCAACGCAGCCGCAGGGAAATATCTCGACGTGTTT
GTGCGCGAAGCTATTGCGAGAGCTGCAGTGGACAAGATTGGCGATTTCTTGGAGGTGAATTTTGGCTTCTACATG
ATGCGTTGAGGGTGCAGCACTGATGGCAGTTTTATGCACGCAGGTTGAGGACCTCGAGAGGATTGCACCCCAGCT
CTTGCTTGATTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail