Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1130
Gene name
LocationContig_127:45702..47156
Strand+
Gene length (bp)1454
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 2.4E-19 243 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94730|YG0I_SCHPO Uncharacterized protein C1604.18c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.18c PE=3 SV=1 15 393 1.0E-26
sp|P47048|YJE9_YEAST Uncharacterized protein YJL049W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL049W PE=1 SV=1 18 370 2.0E-20
sp|Q6BSH2|SNF7_DEBHA Vacuolar-sorting protein SNF7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNF7 PE=3 SV=2 248 404 9.0E-08
sp|Q9P7F7|SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf7 PE=3 SV=1 244 398 1.0E-07
sp|Q86K93|CHMP7_DICDI Charged multivesicular body protein 7 OS=Dictyostelium discoideum GN=chmp7 PE=3 SV=1 29 391 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94730|YG0I_SCHPO Uncharacterized protein C1604.18c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.18c PE=3 SV=1 15 393 1.0E-26
sp|P47048|YJE9_YEAST Uncharacterized protein YJL049W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL049W PE=1 SV=1 18 370 2.0E-20
sp|Q6BSH2|SNF7_DEBHA Vacuolar-sorting protein SNF7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNF7 PE=3 SV=2 248 404 9.0E-08
sp|Q9P7F7|SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf7 PE=3 SV=1 244 398 1.0E-07
sp|Q86K93|CHMP7_DICDI Charged multivesicular body protein 7 OS=Dictyostelium discoideum GN=chmp7 PE=3 SV=1 29 391 5.0E-07
sp|Q7T0X5|CHMP7_XENLA Charged multivesicular body protein 7 OS=Xenopus laevis GN=chmp7 PE=2 SV=1 226 430 3.0E-06
sp|Q753W3|SNF7_ASHGO Vacuolar-sorting protein SNF7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SNF7 PE=3 SV=1 243 379 4.0E-06
sp|P39929|SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF7 PE=1 SV=1 243 366 4.0E-06
sp|Q5FW14|CHMP7_XENTR Charged multivesicular body protein 7 OS=Xenopus tropicalis GN=chmp7 PE=2 SV=1 1 394 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1130
MGELADYLVQHDANFRRSRLPALYSDFRPLKTLNPEGFRANVAAWRDALFMLASKGLLSRHGSGSFILHVDDSLP
RLLESKQYGQPLALGTALGEALVDRHLVPLDSFLQSPPQAGSSHSAWSALPWNALSWTLRQLGISDPLRGEDKVP
KGRFVMMDNVDAAAQDLMQQVLAADDASPFTRVFTKSQLLTTLLEGKKQLSETELQVLLTLMSRDNKSVAYDGNT
IKFVRVGEENTLTEEDAAIASIKELTAHLRHQVSLLNTRIGQLAQEARDAISYKNRVSALAALKSKKLAESSLAQ
RYASLSQVEEVASKIEQASDQVQLVKIMESSAGVLEHLNSKIGGVDRVEGIMDQLRDQVSDTDEVAAILAESTTA
TIDEGEINDELEELLEQEDGKRLEQKQRTEQLEAEAEAAKARAQLNGIRSVPEDIQLEHQREAATPTTETGIAGL
TLNNKEAAKHAQ*
Coding >OphauB2|1130
ATGGGCGAGCTTGCCGACTATCTAGTGCAGCACGACGCCAACTTTCGCAGATCACGACTACCCGCCCTCTACTCC
GACTTTCGACCGCTGAAAACACTAAATCCGGAGGGCTTCAGAGCCAATGTTGCCGCCTGGCGCGATGCCCTCTTC
ATGCTAGCATCCAAGGGTCTACTGTCACGGCACGGCTCTGGCTCCTTTATTCTACACGTCGACGATTCACTGCCT
CGCTTACTCGAGAGCAAGCAATATGGCCAGCCCTTGGCCCTTGGCACCGCTCTCGGCGAAGCACTCGTCGACAGG
CATCTAGTTCCTCTCGATAGTTTCCTGCAATCTCCGCCGCAGGCAGGCTCTAGTCACTCAGCCTGGTCAGCGTTG
CCATGGAATGCTTTGAGCTGGACATTGCGCCAGCTGGGCATTTCAGACCCTTTGCGCGGCGAGGACAAAGTTCCA
AAGGGCCGCTTTGTCATGATGGATAATGTAGATGCTGCAGCTCAAGATTTGATGCAACAGGTGCTCGCTGCTGAT
GACGCTTCGCCCTTCACCCGAGTCTTTACCAAATCGCAGCTCCTCACAACGCTCTTGGAGGGCAAAAAACAATTG
TCCGAAACAGAGCTACAGGTACTACTCACTCTTATGTCTCGTGATAACAAGTCTGTAGCCTATGACGGAAACACG
ATCAAATTTGTTCGCGTGGGCGAAGAAAACACACTCACAGAAGAGGACGCTGCCATCGCTTCAATCAAAGAGTTG
ACGGCCCACTTGAGGCATCAGGTCAGCTTATTGAACACGCGAATCGGTCAACTCGCCCAAGAAGCTAGAGATGCT
ATTAGCTACAAGAACCGCGTTTCTGCCTTGGCGGCACTCAAATCCAAAAAGCTAGCCGAGTCGTCGCTCGCCCAA
AGATATGCATCTCTTAGTCAAGTCGAAGAGGTGGCATCCAAAATTGAACAGGCATCAGACCAGGTACAGCTTGTC
AAGATCATGGAGTCATCTGCTGGTGTCTTGGAACATCTCAACTCCAAAATCGGCGGTGTCGACAGAGTTGAAGGT
ATTATGGACCAGCTCCGAGATCAAGTTAGCGATACGGATGAAGTTGCCGCCATCTTGGCAGAGTCTACAACTGCC
ACCATTGACGAAGGCGAAATCAATGACGAGCTTGAAGAATTACTCGAGCAGGAAGACGGCAAGCGACTGGAGCAA
AAGCAAAGGACAGAGCAACTCGAGGCCGAGGCCGAGGCGGCCAAGGCACGTGCCCAACTCAATGGAATACGATCA
GTTCCAGAAGATATACAGCTGGAGCATCAACGAGAAGCAGCAACGCCTACTACGGAAACCGGCATTGCCGGTCTT
ACACTGAACAATAAAGAGGCTGCTAAGCATGCACAATAG
Transcript >OphauB2|1130
ATGGGCGAGCTTGCCGACTATCTAGTGCAGCACGACGCCAACTTTCGCAGATCACGACTACCCGCCCTCTACTCC
GACTTTCGACCGCTGAAAACACTAAATCCGGAGGGCTTCAGAGCCAATGTTGCCGCCTGGCGCGATGCCCTCTTC
ATGCTAGCATCCAAGGGTCTACTGTCACGGCACGGCTCTGGCTCCTTTATTCTACACGTCGACGATTCACTGCCT
CGCTTACTCGAGAGCAAGCAATATGGCCAGCCCTTGGCCCTTGGCACCGCTCTCGGCGAAGCACTCGTCGACAGG
CATCTAGTTCCTCTCGATAGTTTCCTGCAATCTCCGCCGCAGGCAGGCTCTAGTCACTCAGCCTGGTCAGCGTTG
CCATGGAATGCTTTGAGCTGGACATTGCGCCAGCTGGGCATTTCAGACCCTTTGCGCGGCGAGGACAAAGTTCCA
AAGGGCCGCTTTGTCATGATGGATAATGTAGATGCTGCAGCTCAAGATTTGATGCAACAGGTGCTCGCTGCTGAT
GACGCTTCGCCCTTCACCCGAGTCTTTACCAAATCGCAGCTCCTCACAACGCTCTTGGAGGGCAAAAAACAATTG
TCCGAAACAGAGCTACAGGTACTACTCACTCTTATGTCTCGTGATAACAAGTCTGTAGCCTATGACGGAAACACG
ATCAAATTTGTTCGCGTGGGCGAAGAAAACACACTCACAGAAGAGGACGCTGCCATCGCTTCAATCAAAGAGTTG
ACGGCCCACTTGAGGCATCAGGTCAGCTTATTGAACACGCGAATCGGTCAACTCGCCCAAGAAGCTAGAGATGCT
ATTAGCTACAAGAACCGCGTTTCTGCCTTGGCGGCACTCAAATCCAAAAAGCTAGCCGAGTCGTCGCTCGCCCAA
AGATATGCATCTCTTAGTCAAGTCGAAGAGGTGGCATCCAAAATTGAACAGGCATCAGACCAGGTACAGCTTGTC
AAGATCATGGAGTCATCTGCTGGTGTCTTGGAACATCTCAACTCCAAAATCGGCGGTGTCGACAGAGTTGAAGGT
ATTATGGACCAGCTCCGAGATCAAGTTAGCGATACGGATGAAGTTGCCGCCATCTTGGCAGAGTCTACAACTGCC
ACCATTGACGAAGGCGAAATCAATGACGAGCTTGAAGAATTACTCGAGCAGGAAGACGGCAAGCGACTGGAGCAA
AAGCAAAGGACAGAGCAACTCGAGGCCGAGGCCGAGGCGGCCAAGGCACGTGCCCAACTCAATGGAATACGATCA
GTTCCAGAAGATATACAGCTGGAGCATCAACGAGAAGCAGCAACGCCTACTACGGAAACCGGCATTGCCGGTCTT
ACACTGAACAATAAAGAGGCTGCTAAGCATGCACAATAG
Gene >OphauB2|1130
ATGGGCGAGCTTGCCGACTATCTAGTGCAGCACGACGCCAACTTTCGCAGGTGCCGCTTTGACTCAGCACAGTCT
TGACGACTATTCAGTGTGGTTGAAGCTCACGCCCCATCAGATCACGACTACCCGCCCTCTACTCCGACTTTCGAC
CGCTGAAAACACTAAATCCGGAGGGCTTCAGAGCCAATGTTGCCGCCTGGCGCGATGCCCTCTTCATGCTAGCAT
CCAAGGGTCTACTGTCACGGCACGGCTCTGGCTCCTTTATTCTACACGTCGACGATTCACTGCCTCGCTTACTCG
AGAGCAAGCAATATGGCCAGCCCTTGGCCCTTGGCACCGCTCTCGGCGAAGCACTCGTCGACAGGCATCTAGTTC
CTCTCGATAGTTTCCTGCAATCTCCGCCGCAGGCAGGCTCTAGTCACTCAGCCTGGTCAGCGTTGCCATGGAATG
CTTTGAGCTGGACATTGCGCCAGCTGGGCATTTCAGACCCTTTGCGCGGCGAGGACAAAGTTCCAAAGGGCCGCT
TTGTCATGATGGATAATGTAGATGCTGCAGCTCAAGATTTGATGCAACAGGTGCTCGCTGCTGATGACGCTTCGC
CCTTCACCCGAGTCTTTACCAAATCGCAGCTCCTCACAACGCTCTTGGAGGGCAAAAAACAATTGTCCGAAACAG
AGCTACAGGTACTACTCACTCTTATGTCTCGTGATAACAAGTCTGTAGCCTATGACGGAAACACGATCAAATTTG
TTCGCGTGGGCGAAGAAAACACACTCACAGAAGAGGACGCTGCCATCGCTTCAATCAAAGAGTTGACGGCCCACT
TGAGGCATCAGGTCAGCTTATTGAACACGCGAATCGGTCAACTCGCCCAAGAAGCTAGAGATGCTATTAGCTACA
AGAACCGCGTTTCTGCCTTGGCGGCACTCAAATCCAAAAAGCTAGCCGAGTCGTCGCTCGCCCAAAGATATGCAT
CTCTTAGTCAAGTCGAAGAGGTGGCATCCAAAATTGAACAGGCATCAGACCAGGTACAGCTTGTCAAGATCATGG
AGTCATCTGCTGGTGTCTTGGAACATCTCAACTCCAAAATCGGCGGTGTCGACAGAGTTGAAGGTATTATGGACC
AGCTCCGAGATCAAGTTAGCGATACGGATGAAGTTGCCGCCATCTTGGCAGAGTCTACAACTGCCACCATTGACG
AAGGCGAAATCAATGACGAGCTTGAAGAATTACTCGAGCAGGAAGACGGCAAGCGACTGGAGCAAAAGCAAAGGA
CAGAGCAACTCGAGGCCGAGGCCGAGGCGGCCAAGGCACGTGCCCAACTCAATGGAATACGATCAGTTCCAGAAG
ATATACAGCTGGAGCATCAACGAGAAGCAGCAACGCCTACTACGGAAACCGGCATTGCCGGTCTTACACTGAACA
ATAAAGAGGCTGCTAAGCATGCACAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail