Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1123
Gene name
LocationContig_127:27367..29086
Strand-
Gene length (bp)1719
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase 3.1E-40 5 120
PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain 3.0E-26 381 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32895|KPR1_YEAST Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 1 198 3.0E-86
sp|P41831|KPR1_SCHPO Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 1 215 9.0E-86
sp|P21108|PRPS3_HUMAN Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 1 216 5.0E-68
sp|Q5XGI0|PRPS2_XENTR Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 1 216 4.0E-67
sp|Q7ZXC9|PRPS2_XENLA Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 1 216 2.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32895|KPR1_YEAST Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 1 198 3.0E-86
sp|P41831|KPR1_SCHPO Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 1 215 9.0E-86
sp|P21108|PRPS3_HUMAN Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 1 216 5.0E-68
sp|Q5XGI0|PRPS2_XENTR Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 1 216 4.0E-67
sp|Q7ZXC9|PRPS2_XENLA Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 1 216 2.0E-66
sp|Q4R4U3|PRPS1_MACFA Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis GN=PRPS1 PE=2 SV=1 1 216 4.0E-66
sp|P60892|PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus GN=Prps1 PE=1 SV=2 1 216 5.0E-66
sp|Q5RFJ7|PRPS1_PONAB Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii GN=PRPS1 PE=2 SV=1 1 216 5.0E-66
sp|Q9D7G0|PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus GN=Prps1 PE=1 SV=4 1 216 5.0E-66
sp|P60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens GN=PRPS1 PE=1 SV=2 1 216 5.0E-66
sp|Q2HJ58|PRPS1_BOVIN Ribose-phosphate pyrophosphokinase 1 OS=Bos taurus GN=PRPS1 PE=2 SV=3 1 216 5.0E-66
sp|Q9CS42|PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus GN=Prps2 PE=1 SV=4 1 216 8.0E-66
sp|P09330|PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus GN=Prps2 PE=1 SV=3 1 216 9.0E-66
sp|Q5R8F8|PRPS2_PONAB Ribose-phosphate pyrophosphokinase 2 OS=Pongo abelii GN=PRPS2 PE=2 SV=1 1 216 3.0E-65
sp|Q4R4R7|PRPS2_MACFA Ribose-phosphate pyrophosphokinase 2 OS=Macaca fascicularis GN=PRPS2 PE=2 SV=3 1 216 3.0E-65
sp|P11908|PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens GN=PRPS2 PE=1 SV=2 1 216 3.0E-65
sp|Q5ZI49|PRPS2_CHICK Ribose-phosphate pyrophosphokinase 2 OS=Gallus gallus GN=PRPS2 PE=2 SV=1 1 216 1.0E-61
sp|O94413|KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.06c PE=1 SV=1 6 199 2.0E-61
sp|P38063|KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS4 PE=1 SV=3 6 208 3.0E-58
sp|P38620|KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS2 PE=1 SV=1 6 208 2.0E-57
sp|P87171|KPR5_SCHPO Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 1 207 3.0E-56
sp|Q54PA9|PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum GN=prsA PE=1 SV=1 6 199 5.0E-52
sp|P46585|KPR1_CANAX Ribose-phosphate pyrophosphokinase 1 OS=Candida albicans GN=PRS1 PE=3 SV=1 15 216 1.0E-51
sp|P38689|KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS3 PE=1 SV=1 15 216 7.0E-51
sp|O08618|KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=1 SV=1 5 192 3.0E-47
sp|O60256|KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens GN=PRPSAP2 PE=1 SV=1 5 192 3.0E-47
sp|Q5RBA8|KPRB_PONAB Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 5 192 3.0E-47
sp|Q8R574|KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 5 192 3.0E-47
sp|Q5ZL26|KPRB_CHICK Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 5 192 4.0E-47
sp|A2VDS0|KPRB_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 5 192 2.0E-46
sp|Q28DH0|KPRB_XENTR Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 5 192 2.0E-46
sp|Q97E93|KPRS_CLOAB Ribose-phosphate pyrophosphokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prs PE=3 SV=1 2 209 5.0E-46
sp|Q8XHJ4|KPRS_CLOPE Ribose-phosphate pyrophosphokinase OS=Clostridium perfringens (strain 13 / Type A) GN=prs PE=3 SV=1 2 216 5.0E-46
sp|Q14558|KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 6 209 1.0E-45
sp|Q08DW2|KPRA_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 6 192 1.0E-45
sp|Q9D0M1|KPRA_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 6 209 1.0E-45
sp|Q8RHM2|KPRS_FUSNN Ribose-phosphate pyrophosphokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prs PE=3 SV=1 3 219 1.0E-45
sp|B7IFM5|KPRS_THEAB Ribose-phosphate pyrophosphokinase OS=Thermosipho africanus (strain TCF52B) GN=prs PE=3 SV=1 6 219 2.0E-45
sp|Q63468|KPRA_RAT Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 6 209 3.0E-45
sp|Q8R753|KPRS_CALS4 Ribose-phosphate pyrophosphokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prs PE=3 SV=1 6 209 1.0E-44
sp|Q8Y2E1|KPRS_RALSO Ribose-phosphate pyrophosphokinase OS=Ralstonia solanacearum (strain GMI1000) GN=prs PE=3 SV=1 5 217 1.0E-44
sp|Q7M8J0|KPRS_WOLSU Ribose-phosphate pyrophosphokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prs PE=3 SV=1 1 209 3.0E-44
sp|Q8EZN0|KPRS_LEPIN Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prs PE=3 SV=1 6 209 5.0E-44
sp|Q72V73|KPRS_LEPIC Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prs PE=3 SV=1 6 209 6.0E-44
sp|P56184|KPRS_HELPY Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prs PE=3 SV=1 1 217 9.0E-44
sp|Q9X1W3|KPRS_THEMA Ribose-phosphate pyrophosphokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prs PE=3 SV=1 6 209 1.0E-43
sp|Q9ZLA1|KPRS_HELPJ Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prs PE=3 SV=1 1 217 1.0E-43
sp|Q75JN8|PRPSB_DICDI Ribose-phosphate pyrophosphokinase B OS=Dictyostelium discoideum GN=prsB PE=3 SV=1 5 192 2.0E-43
sp|Q92N73|KPRS_RHIME Ribose-phosphate pyrophosphokinase OS=Rhizobium meliloti (strain 1021) GN=prs PE=3 SV=1 6 207 3.0E-43
sp|Q7NQS9|KPRS_CHRVO Ribose-phosphate pyrophosphokinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prs PE=3 SV=1 5 216 3.0E-43
sp|P65240|KPRS1_STRR6 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs1 PE=3 SV=1 6 218 5.0E-43
sp|P65239|KPRS1_STRPN Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs1 PE=3 SV=1 6 218 5.0E-43
sp|Q9PP15|KPRS_CAMJE Ribose-phosphate pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prs PE=3 SV=1 1 218 5.0E-43
sp|P32895|KPR1_YEAST Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 343 493 1.0E-42
sp|Q8EU34|KPRS_OCEIH Ribose-phosphate pyrophosphokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prs PE=3 SV=1 6 219 1.0E-42
sp|Q6AJL7|KPRS_DESPS Ribose-phosphate pyrophosphokinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prs PE=3 SV=1 6 198 1.0E-42
sp|Q899I8|KPRS_CLOTE Ribose-phosphate pyrophosphokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=prs PE=3 SV=1 6 209 2.0E-42
sp|Q8YIG1|KPRS_BRUME Ribose-phosphate pyrophosphokinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prs PE=3 SV=2 6 207 3.0E-42
sp|Q8FZF0|KPRS_BRUSU Ribose-phosphate pyrophosphokinase OS=Brucella suis biovar 1 (strain 1330) GN=prs PE=3 SV=1 6 207 3.0E-42
sp|P42816|KPRS_BACCL Ribose-phosphate pyrophosphokinase OS=Bacillus caldolyticus GN=prs PE=3 SV=1 6 209 4.0E-42
sp|Q7UPM4|KPRS_RHOBA Ribose-phosphate pyrophosphokinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=prs PE=3 SV=1 1 198 4.0E-42
sp|Q9KQ22|KPRS_VIBCH Ribose-phosphate pyrophosphokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prs PE=3 SV=1 1 216 5.0E-42
sp|Q54QU9|PRPSC_DICDI Ribose-phosphate pyrophosphokinase C OS=Dictyostelium discoideum GN=prsC PE=3 SV=1 1 197 8.0E-42
sp|P14193|KPRS_BACSU Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=prs PE=1 SV=1 2 219 8.0E-42
sp|Q9KGJ5|KPRS_BACHD Ribose-phosphate pyrophosphokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prs PE=3 SV=1 3 219 1.0E-41
sp|Q81J97|KPRS_BACCR Ribose-phosphate pyrophosphokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prs PE=3 SV=1 3 219 2.0E-41
sp|Q81VZ0|KPRS_BACAN Ribose-phosphate pyrophosphokinase OS=Bacillus anthracis GN=prs PE=3 SV=1 3 219 2.0E-41
sp|Q8ZEY2|KPRS_YERPE Ribose-phosphate pyrophosphokinase OS=Yersinia pestis GN=prs PE=3 SV=1 1 216 2.0E-41
sp|O33924|KPRS_CORAM Ribose-phosphate pyrophosphokinase OS=Corynebacterium ammoniagenes GN=prs PE=3 SV=1 3 219 2.0E-41
sp|P0DB99|KPRS1_STRPQ Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|P65245|KPRS1_STRP8 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|Q5XEL0|KPRS1_STRP6 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs1 PE=3 SV=2 6 209 2.0E-41
sp|P0DB98|KPRS1_STRP3 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|P65243|KPRS1_STRP1 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M1 GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|P44328|KPRS_HAEIN Ribose-phosphate pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prs PE=3 SV=1 1 216 2.0E-41
sp|Q9HVC5|KPRS_PSEAE Ribose-phosphate pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prs PE=3 SV=1 1 218 3.0E-41
sp|Q8DWM2|KPRS1_STRMU Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs1 PE=3 SV=1 3 209 4.0E-41
sp|Q9RUD2|KPRS_DEIRA Ribose-phosphate pyrophosphokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=prs PE=3 SV=2 5 198 4.0E-41
sp|P0A717|KPRS_ECOLI Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) GN=prs PE=1 SV=2 1 216 5.0E-41
sp|P0A718|KPRS_ECOL6 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prs PE=3 SV=2 1 216 5.0E-41
sp|P0A719|KPRS_ECO57 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O157:H7 GN=prs PE=3 SV=2 1 216 5.0E-41
sp|P0A1V6|KPRS_SALTY Ribose-phosphate pyrophosphokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prs PE=3 SV=2 1 216 6.0E-41
sp|P0A1V7|KPRS_SALTI Ribose-phosphate pyrophosphokinase OS=Salmonella typhi GN=prs PE=3 SV=2 1 216 6.0E-41
sp|Q87RN8|KPRS_VIBPA Ribose-phosphate pyrophosphokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prs PE=3 SV=1 1 216 8.0E-41
sp|Q82ZA5|KPRS2_ENTFA Ribose-phosphate pyrophosphokinase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs2 PE=3 SV=1 6 218 9.0E-41
sp|Q7MMZ1|KPRS_VIBVY Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain YJ016) GN=prs PE=3 SV=1 1 216 1.0E-40
sp|Q8DFF5|KPRS_VIBVU Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain CMCP6) GN=prs PE=3 SV=2 1 216 1.0E-40
sp|P9WKE3|KPRS_MYCTU Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prs PE=1 SV=1 2 216 1.0E-40
sp|P9WKE2|KPRS_MYCTO Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prs PE=3 SV=1 2 216 1.0E-40
sp|P65233|KPRS_MYCBO Ribose-phosphate pyrophosphokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prs PE=3 SV=1 2 216 1.0E-40
sp|Q8E2H0|KPRS1_STRA5 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs1 PE=3 SV=1 3 209 1.0E-40
sp|Q8E7X8|KPRS1_STRA3 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs1 PE=3 SV=1 3 209 1.0E-40
sp|Q7MT83|KPRS_PORGI Ribose-phosphate pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prs PE=3 SV=1 3 185 1.0E-40
sp|Q7W181|KPRS_BORPA Ribose-phosphate pyrophosphokinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prs PE=3 SV=1 5 218 2.0E-40
sp|Q7WNY4|KPRS_BORBR Ribose-phosphate pyrophosphokinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prs PE=3 SV=1 5 218 2.0E-40
sp|Q8UDA9|KPRS_AGRFC Ribose-phosphate pyrophosphokinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=prs PE=3 SV=2 6 207 2.0E-40
sp|Q98HW3|KPRS_RHILO Ribose-phosphate pyrophosphokinase OS=Rhizobium loti (strain MAFF303099) GN=prs PE=3 SV=1 6 207 3.0E-40
sp|Q88PX6|KPRS_PSEPK Ribose-phosphate pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=prs PE=3 SV=1 1 199 3.0E-40
sp|P65235|KPRS_NEIMB Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=prs PE=1 SV=1 5 218 3.0E-40
sp|P65234|KPRS_NEIMA Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prs PE=3 SV=1 5 218 3.0E-40
sp|Q7N590|KPRS_PHOLL Ribose-phosphate pyrophosphokinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prs PE=3 SV=1 1 216 3.0E-40
sp|Q888C6|KPRS_PSESM Ribose-phosphate pyrophosphokinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prs PE=3 SV=1 1 199 3.0E-40
sp|Q7VUH1|KPRS_BORPE Ribose-phosphate pyrophosphokinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prs PE=3 SV=2 5 218 4.0E-40
sp|Q82TQ4|KPRS_NITEU Ribose-phosphate pyrophosphokinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prs PE=3 SV=1 5 209 5.0E-40
sp|Q8KCQ2|KPRS_CHLTE Ribose-phosphate pyrophosphokinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prs PE=3 SV=1 6 209 6.0E-40
sp|Q7VL55|KPRS_HAEDU Ribose-phosphate pyrophosphokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prs PE=3 SV=1 1 216 8.0E-40
sp|Q5HIH5|KPRS_STAAC Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain COL) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|P65238|KPRS_STAAW Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|Q6GBY8|KPRS_STAAS Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|Q6GJH1|KPRS_STAAR Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|P65237|KPRS_STAAN Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=prs PE=1 SV=1 6 219 1.0E-39
sp|P65236|KPRS_STAAM Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|Q1LTH2|KPRS_BAUCH Ribose-phosphate pyrophosphokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prs PE=3 SV=1 6 216 1.0E-39
sp|Q7VR76|KPRS_BLOFL Ribose-phosphate pyrophosphokinase OS=Blochmannia floridanus GN=prs PE=3 SV=1 6 216 2.0E-39
sp|Q8K9X2|KPRS_BUCAP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prs PE=3 SV=1 1 216 2.0E-39
sp|Q8PNU0|KPRS_XANAC Ribose-phosphate pyrophosphokinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prs PE=3 SV=2 2 209 3.0E-39
sp|Q9CD45|KPRS_MYCLE Ribose-phosphate pyrophosphokinase OS=Mycobacterium leprae (strain TN) GN=prs PE=3 SV=1 2 185 4.0E-39
sp|Q9CHB8|KPRS1_LACLA Ribose-phosphate pyrophosphokinase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs1 PE=3 SV=1 3 209 4.0E-39
sp|Q9CEI4|KPRS2_LACLA Ribose-phosphate pyrophosphokinase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs2 PE=3 SV=1 6 192 4.0E-39
sp|Q9PA76|KPRS_XYLFA Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain 9a5c) GN=prs PE=3 SV=2 2 209 6.0E-39
sp|Q87A22|KPRS_XYLFT Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prs PE=3 SV=1 2 209 6.0E-39
sp|Q7VFY9|KPRS_HELHP Ribose-phosphate pyrophosphokinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prs PE=3 SV=1 1 212 6.0E-39
sp|Q9CP22|KPRS_PASMU Ribose-phosphate pyrophosphokinase OS=Pasteurella multocida (strain Pm70) GN=prs PE=3 SV=1 1 216 6.0E-39
sp|O67556|KPRS_AQUAE Ribose-phosphate pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=prs PE=3 SV=1 1 209 6.0E-39
sp|Q9AAV6|KPRS_CAUCR Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prs PE=3 SV=1 6 217 7.0E-39
sp|B8GZV1|KPRS_CAUCN Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prs PE=3 SV=1 6 217 7.0E-39
sp|Q49V09|KPRS_STAS1 Ribose-phosphate pyrophosphokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=prs PE=3 SV=1 6 219 7.0E-39
sp|Q8CQU7|KPRS_STAES Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prs PE=3 SV=1 6 219 7.0E-39
sp|Q5HRQ5|KPRS_STAEQ Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prs PE=3 SV=1 6 219 7.0E-39
sp|P57266|KPRS_BUCAI Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prs PE=3 SV=1 1 216 7.0E-39
sp|Q4L3F7|KPRS_STAHJ Ribose-phosphate pyrophosphokinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prs PE=3 SV=1 6 219 8.0E-39
sp|Q8PC63|KPRS_XANCP Ribose-phosphate pyrophosphokinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prs PE=3 SV=1 2 209 8.0E-39
sp|Q8FQV2|KPRS_COREF Ribose-phosphate pyrophosphokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prs PE=3 SV=1 2 185 9.0E-39
sp|A6W1C7|KPRS_MARMS Ribose-phosphate pyrophosphokinase OS=Marinomonas sp. (strain MWYL1) GN=prs PE=3 SV=1 1 218 9.0E-39
sp|Q7VBH4|KPRS_PROMA Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=prs PE=3 SV=1 6 199 1.0E-38
sp|Q89DJ1|KPRS_BRADU Ribose-phosphate pyrophosphokinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prs PE=3 SV=2 6 207 2.0E-38
sp|Q88Z84|KPRS1_LACPL Ribose-phosphate pyrophosphokinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs1 PE=3 SV=1 6 217 2.0E-38
sp|Q7NM67|KPRS_GLOVI Ribose-phosphate pyrophosphokinase OS=Gloeobacter violaceus (strain PCC 7421) GN=prs PE=3 SV=1 6 219 2.0E-38
sp|Q99ZR0|KPRS2_STRP1 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M1 GN=prs2 PE=3 SV=1 34 199 2.0E-38
sp|Q8EAQ9|KPRS_SHEON Ribose-phosphate pyrophosphokinase OS=Shewanella oneidensis (strain MR-1) GN=prs PE=3 SV=1 1 216 4.0E-38
sp|Q8NRU9|KPRS_CORGL Ribose-phosphate pyrophosphokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prs PE=3 SV=1 2 185 5.0E-38
sp|Q0BPP0|KPRS_GRABC Ribose-phosphate pyrophosphokinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prs PE=3 SV=1 6 199 8.0E-38
sp|Q0ARN5|KPRS_MARMM Ribose-phosphate pyrophosphokinase OS=Maricaulis maris (strain MCS10) GN=prs PE=3 SV=1 6 217 8.0E-38
sp|P65242|KPRS2_STRR6 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs2 PE=3 SV=1 2 185 9.0E-38
sp|P65241|KPRS2_STRPN Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs2 PE=3 SV=1 2 185 9.0E-38
sp|Q5XC85|KPRS2_STRP6 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs2 PE=1 SV=1 34 199 1.0E-37
sp|Q7V6S2|KPRS_PROMM Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain MIT 9313) GN=prs PE=3 SV=1 1 206 1.0E-37
sp|Q8DZK4|KPRS2_STRA5 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs2 PE=3 SV=1 34 199 1.0E-37
sp|Q8E568|KPRS2_STRA3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs2 PE=3 SV=1 34 199 1.0E-37
sp|Q55848|KPRS_SYNY3 Ribose-phosphate pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prs PE=3 SV=1 6 219 2.0E-37
sp|P47304|KPRS_MYCGE Ribose-phosphate pyrophosphokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prs PE=3 SV=2 2 211 2.0E-37
sp|P0DC01|KPRS2_STRPQ Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs2 PE=3 SV=1 34 199 3.0E-37
sp|P0DC00|KPRS2_STRP3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs2 PE=3 SV=1 34 199 3.0E-37
sp|Q6Z2L5|KPRS1_ORYSJ Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0127700 PE=2 SV=2 6 198 4.0E-37
sp|Q0C5A1|KPRS_HYPNA Ribose-phosphate pyrophosphokinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=prs PE=3 SV=1 15 209 4.0E-37
sp|Q88VA5|KPRS2_LACPL Ribose-phosphate pyrophosphokinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs2 PE=3 SV=1 6 185 1.0E-36
sp|Q832Z5|KPRS1_ENTFA Ribose-phosphate pyrophosphokinase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs1 PE=3 SV=1 6 199 1.0E-36
sp|Q8P137|KPRS2_STRP8 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs2 PE=3 SV=1 34 199 1.0E-36
sp|Q7V111|KPRS_PROMP Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=prs PE=3 SV=1 6 198 1.0E-36
sp|P75044|KPRS_MYCPN Ribose-phosphate pyrophosphokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prs PE=3 SV=3 3 198 1.0E-36
sp|P59512|KPRS_BUCBP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=prs PE=3 SV=1 1 209 1.0E-36
sp|O64888|KPRS5_ARATH Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PRS5 PE=2 SV=2 6 198 2.0E-36
sp|Q9XG98|KPRS1_SPIOL Ribose-phosphate pyrophosphokinase 1 OS=Spinacia oleracea GN=PRS1 PE=2 SV=1 6 198 2.0E-36
sp|Q8DU94|KPRS2_STRMU Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs2 PE=3 SV=1 6 185 2.0E-36
sp|Q7U7L5|KPRS_SYNPX Ribose-phosphate pyrophosphokinase OS=Synechococcus sp. (strain WH8102) GN=prs PE=3 SV=1 2 206 2.0E-36
sp|Q83TK1|KPRS_LISWE Ribose-phosphate pyrophosphokinase OS=Listeria welshimeri GN=prs PE=3 SV=1 6 209 2.0E-36
sp|Q83YI7|KPRS_LISIV Ribose-phosphate pyrophosphokinase OS=Listeria ivanovii GN=prs PE=3 SV=1 6 209 2.0E-36
sp|Q92F68|KPRS1_LISIN Ribose-phosphate pyrophosphokinase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs1 PE=3 SV=1 6 209 2.0E-36
sp|Q48793|KPRS1_LISMO Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs1 PE=3 SV=1 6 209 2.0E-36
sp|Q724L4|KPRS1_LISMF Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs1 PE=3 SV=1 6 209 2.0E-36
sp|Q59988|KPRS_SYNE7 Ribose-phosphate pyrophosphokinase OS=Synechococcus elongatus (strain PCC 7942) GN=prs PE=3 SV=1 6 198 4.0E-36
sp|Q8Y9L8|KPRS2_LISMO Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs2 PE=3 SV=1 6 200 8.0E-36
sp|Q42583|KPRS2_ARATH Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Arabidopsis thaliana GN=PRS2 PE=2 SV=2 6 198 1.0E-35
sp|Q9XG99|KPRS2_SPIOL Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Spinacia oleracea GN=PRS2 PE=2 SV=1 6 198 1.0E-35
sp|Q723E1|KPRS2_LISMF Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs2 PE=3 SV=1 6 200 1.0E-35
sp|Q8YN97|KPRS_NOSS1 Ribose-phosphate pyrophosphokinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prs PE=3 SV=1 6 219 5.0E-35
sp|Q92EF1|KPRS2_LISIN Ribose-phosphate pyrophosphokinase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs2 PE=3 SV=1 6 200 9.0E-35
sp|Q42581|KPRS1_ARATH Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Arabidopsis thaliana GN=PRS1 PE=2 SV=2 6 198 9.0E-35
sp|Q82HE7|KPRS_STRAW Ribose-phosphate pyrophosphokinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prs PE=3 SV=1 2 198 1.0E-34
sp|B9KPJ0|KPRS_RHOSK Ribose-phosphate pyrophosphokinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prs PE=3 SV=1 29 198 6.0E-34
sp|Q9K3U0|KPRS_STRCO Ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prs PE=3 SV=1 2 198 7.0E-34
sp|Q69XQ6|KPRS2_ORYSJ Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0617800 PE=2 SV=2 6 198 8.0E-34
sp|Q8G5P2|KPRS_BIFLO Ribose-phosphate pyrophosphokinase OS=Bifidobacterium longum (strain NCC 2705) GN=prs PE=3 SV=2 2 173 8.0E-33
sp|Q83AQ1|KPRS_COXBU Ribose-phosphate pyrophosphokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prs PE=3 SV=1 6 209 2.0E-32
sp|P41831|KPR1_SCHPO Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 309 493 1.0E-31
sp|Q98R83|KPRS_MYCPU Ribose-phosphate pyrophosphokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prs PE=3 SV=1 4 207 1.0E-31
sp|Q9EWS0|KPRH_STRCO Putative ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0782 PE=3 SV=1 1 185 1.0E-31
sp|Q12265|KPR5_YEAST Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 1 97 4.0E-28
sp|Q9PQV0|KPRS_UREPA Ribose-phosphate pyrophosphokinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=prs PE=3 SV=1 3 198 1.0E-26
sp|Q12265|KPR5_YEAST Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 111 216 1.0E-21
sp|Q4R4U3|PRPS1_MACFA Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis GN=PRPS1 PE=2 SV=1 382 496 4.0E-21
sp|P60892|PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus GN=Prps1 PE=1 SV=2 382 496 4.0E-21
sp|Q5RFJ7|PRPS1_PONAB Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii GN=PRPS1 PE=2 SV=1 382 496 4.0E-21
sp|Q9D7G0|PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus GN=Prps1 PE=1 SV=4 382 496 4.0E-21
sp|P60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens GN=PRPS1 PE=1 SV=2 382 496 4.0E-21
sp|Q2HJ58|PRPS1_BOVIN Ribose-phosphate pyrophosphokinase 1 OS=Bos taurus GN=PRPS1 PE=2 SV=3 382 496 4.0E-21
sp|Q9CS42|PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus GN=Prps2 PE=1 SV=4 382 496 1.0E-20
sp|Q5XGI0|PRPS2_XENTR Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 382 496 3.0E-20
sp|P09330|PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus GN=Prps2 PE=1 SV=3 382 496 3.0E-20
sp|Q5R8F8|PRPS2_PONAB Ribose-phosphate pyrophosphokinase 2 OS=Pongo abelii GN=PRPS2 PE=2 SV=1 382 496 6.0E-20
sp|Q4R4R7|PRPS2_MACFA Ribose-phosphate pyrophosphokinase 2 OS=Macaca fascicularis GN=PRPS2 PE=2 SV=3 382 496 6.0E-20
sp|P11908|PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens GN=PRPS2 PE=1 SV=2 382 496 6.0E-20
sp|Q7ZXC9|PRPS2_XENLA Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 382 496 1.0E-19
sp|Q54PA9|PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum GN=prsA PE=1 SV=1 360 496 1.0E-19
sp|P21108|PRPS3_HUMAN Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 382 496 2.0E-19
sp|Q5ZI49|PRPS2_CHICK Ribose-phosphate pyrophosphokinase 2 OS=Gallus gallus GN=PRPS2 PE=2 SV=1 382 496 8.0E-19
sp|P38689|KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS3 PE=1 SV=1 309 493 2.0E-17
sp|O94413|KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.06c PE=1 SV=1 357 493 3.0E-17
sp|A5UNK4|KPRS_METS3 Ribose-phosphate pyrophosphokinase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=prs PE=3 SV=1 5 209 4.0E-17
sp|Q12265|KPR5_YEAST Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 384 495 1.0E-16
sp|O26877|KPRS_METTH Ribose-phosphate pyrophosphokinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=prs PE=3 SV=1 31 185 1.0E-16
sp|P44328|KPRS_HAEIN Ribose-phosphate pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prs PE=3 SV=1 380 493 3.0E-16
sp|Q87RN8|KPRS_VIBPA Ribose-phosphate pyrophosphokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prs PE=3 SV=1 380 493 4.0E-16
sp|P38063|KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS4 PE=1 SV=3 357 495 5.0E-16
sp|Q9KQ22|KPRS_VIBCH Ribose-phosphate pyrophosphokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prs PE=3 SV=1 380 493 1.0E-15
sp|Q7MMZ1|KPRS_VIBVY Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain YJ016) GN=prs PE=3 SV=1 380 493 1.0E-15
sp|Q8DFF5|KPRS_VIBVU Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain CMCP6) GN=prs PE=3 SV=2 380 493 1.0E-15
sp|Q7VL55|KPRS_HAEDU Ribose-phosphate pyrophosphokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prs PE=3 SV=1 374 493 1.0E-15
sp|P87171|KPR5_SCHPO Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 382 495 2.0E-15
sp|Q9CP22|KPRS_PASMU Ribose-phosphate pyrophosphokinase OS=Pasteurella multocida (strain Pm70) GN=prs PE=3 SV=1 380 493 2.0E-15
sp|O67556|KPRS_AQUAE Ribose-phosphate pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=prs PE=3 SV=1 376 493 2.0E-15
sp|Q7M8J0|KPRS_WOLSU Ribose-phosphate pyrophosphokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prs PE=3 SV=1 314 494 3.0E-15
sp|Q8K9X2|KPRS_BUCAP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prs PE=3 SV=1 376 495 3.0E-15
sp|Q973F3|KPRS_SULTO Ribose-phosphate pyrophosphokinase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=prs PE=3 SV=1 35 198 1.0E-14
sp|P57266|KPRS_BUCAI Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prs PE=3 SV=1 380 495 2.0E-14
sp|Q8TRK8|KPRS_METAC Ribose-phosphate pyrophosphokinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prs PE=3 SV=1 6 155 2.0E-14
sp|Q8PUX3|KPRS_METMA Ribose-phosphate pyrophosphokinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=prs PE=3 SV=1 6 155 2.0E-14
sp|P46585|KPR1_CANAX Ribose-phosphate pyrophosphokinase 1 OS=Candida albicans GN=PRS1 PE=3 SV=1 309 493 3.0E-14
sp|Q97E93|KPRS_CLOAB Ribose-phosphate pyrophosphokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prs PE=3 SV=1 376 493 3.0E-14
sp|Q7N590|KPRS_PHOLL Ribose-phosphate pyrophosphokinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prs PE=3 SV=1 380 495 4.0E-14
sp|Q7VR76|KPRS_BLOFL Ribose-phosphate pyrophosphokinase OS=Blochmannia floridanus GN=prs PE=3 SV=1 380 496 4.0E-14
sp|Q7U7L5|KPRS_SYNPX Ribose-phosphate pyrophosphokinase OS=Synechococcus sp. (strain WH8102) GN=prs PE=3 SV=1 382 493 5.0E-14
sp|P38620|KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS2 PE=1 SV=1 357 495 6.0E-14
sp|Q8EAQ9|KPRS_SHEON Ribose-phosphate pyrophosphokinase OS=Shewanella oneidensis (strain MR-1) GN=prs PE=3 SV=1 367 495 7.0E-14
sp|P59512|KPRS_BUCBP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=prs PE=3 SV=1 380 495 7.0E-14
sp|P0A717|KPRS_ECOLI Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) GN=prs PE=1 SV=2 380 495 8.0E-14
sp|P0A718|KPRS_ECOL6 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prs PE=3 SV=2 380 495 8.0E-14
sp|P0A719|KPRS_ECO57 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O157:H7 GN=prs PE=3 SV=2 380 495 8.0E-14
sp|Q7VBH4|KPRS_PROMA Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=prs PE=3 SV=1 382 493 1.0E-13
sp|Q9ZLA1|KPRS_HELPJ Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prs PE=3 SV=1 314 493 2.0E-13
sp|P0A1V6|KPRS_SALTY Ribose-phosphate pyrophosphokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prs PE=3 SV=2 380 495 2.0E-13
sp|P0A1V7|KPRS_SALTI Ribose-phosphate pyrophosphokinase OS=Salmonella typhi GN=prs PE=3 SV=2 380 495 2.0E-13
sp|P65235|KPRS_NEIMB Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=prs PE=1 SV=1 374 493 2.0E-13
sp|P65234|KPRS_NEIMA Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prs PE=3 SV=1 374 493 2.0E-13
sp|Q97Z86|KPRS_SULSO Ribose-phosphate pyrophosphokinase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=prs PE=1 SV=2 5 198 2.0E-13
sp|Q8R753|KPRS_CALS4 Ribose-phosphate pyrophosphokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prs PE=3 SV=1 380 493 3.0E-13
sp|Q8ZEY2|KPRS_YERPE Ribose-phosphate pyrophosphokinase OS=Yersinia pestis GN=prs PE=3 SV=1 380 495 3.0E-13
sp|Q87A22|KPRS_XYLFT Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prs PE=3 SV=1 381 494 3.0E-13
sp|Q9PA76|KPRS_XYLFA Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain 9a5c) GN=prs PE=3 SV=2 381 494 4.0E-13
sp|P56184|KPRS_HELPY Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prs PE=3 SV=1 314 493 5.0E-13
sp|Q59988|KPRS_SYNE7 Ribose-phosphate pyrophosphokinase OS=Synechococcus elongatus (strain PCC 7942) GN=prs PE=3 SV=1 380 493 5.0E-13
sp|Q4J9A6|KPRS_SULAC Ribose-phosphate pyrophosphokinase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=prs PE=3 SV=1 5 196 8.0E-13
sp|Q7NM67|KPRS_GLOVI Ribose-phosphate pyrophosphokinase OS=Gloeobacter violaceus (strain PCC 7421) GN=prs PE=3 SV=1 370 493 9.0E-13
sp|Q8EZN0|KPRS_LEPIN Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prs PE=3 SV=1 374 493 1.0E-12
sp|Q72V73|KPRS_LEPIC Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prs PE=3 SV=1 374 493 1.0E-12
sp|Q83AQ1|KPRS_COXBU Ribose-phosphate pyrophosphokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prs PE=3 SV=1 376 494 1.0E-12
sp|O59586|KPRS_PYRHO Ribose-phosphate pyrophosphokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prs PE=3 SV=1 3 196 1.0E-12
sp|O60256|KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens GN=PRPSAP2 PE=1 SV=1 382 497 2.0E-12
sp|Q9PP15|KPRS_CAMJE Ribose-phosphate pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prs PE=3 SV=1 380 494 2.0E-12
sp|Q8KCQ2|KPRS_CHLTE Ribose-phosphate pyrophosphokinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prs PE=3 SV=1 374 493 2.0E-12
sp|Q98R83|KPRS_MYCPU Ribose-phosphate pyrophosphokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prs PE=3 SV=1 380 493 2.0E-12
sp|Q88PX6|KPRS_PSEPK Ribose-phosphate pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=prs PE=3 SV=1 374 493 3.0E-12
sp|Q888C6|KPRS_PSESM Ribose-phosphate pyrophosphokinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prs PE=3 SV=1 374 493 3.0E-12
sp|O08618|KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=1 SV=1 382 497 4.0E-12
sp|Q5RBA8|KPRB_PONAB Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 382 497 4.0E-12
sp|Q8R574|KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 382 497 4.0E-12
sp|Q5ZL26|KPRB_CHICK Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 382 497 4.0E-12
sp|Q8EU34|KPRS_OCEIH Ribose-phosphate pyrophosphokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prs PE=3 SV=1 376 493 4.0E-12
sp|Q6AJL7|KPRS_DESPS Ribose-phosphate pyrophosphokinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prs PE=3 SV=1 376 494 4.0E-12
sp|Q7V111|KPRS_PROMP Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=prs PE=3 SV=1 382 493 4.0E-12
sp|Q8YN97|KPRS_NOSS1 Ribose-phosphate pyrophosphokinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prs PE=3 SV=1 380 493 4.0E-12
sp|Q9RUD2|KPRS_DEIRA Ribose-phosphate pyrophosphokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=prs PE=3 SV=2 384 493 5.0E-12
sp|Q9HLV6|KPRS_THEAC Ribose-phosphate pyrophosphokinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=prs PE=3 SV=2 6 218 5.0E-12
sp|Q7NQS9|KPRS_CHRVO Ribose-phosphate pyrophosphokinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prs PE=3 SV=1 374 493 6.0E-12
sp|P42816|KPRS_BACCL Ribose-phosphate pyrophosphokinase OS=Bacillus caldolyticus GN=prs PE=3 SV=1 376 493 6.0E-12
sp|Q7UPM4|KPRS_RHOBA Ribose-phosphate pyrophosphokinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=prs PE=3 SV=1 359 493 7.0E-12
sp|Q7VFY9|KPRS_HELHP Ribose-phosphate pyrophosphokinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prs PE=3 SV=1 314 494 7.0E-12
sp|Q58761|KPRS_METJA Ribose-phosphate pyrophosphokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=prs PE=1 SV=2 5 156 7.0E-12
sp|A6W1C7|KPRS_MARMS Ribose-phosphate pyrophosphokinase OS=Marinomonas sp. (strain MWYL1) GN=prs PE=3 SV=1 380 493 9.0E-12
sp|A2VDS0|KPRB_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 382 497 2.0E-11
sp|Q28DH0|KPRB_XENTR Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 375 497 2.0E-11
sp|Q63468|KPRA_RAT Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 382 493 2.0E-11
sp|P14193|KPRS_BACSU Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=prs PE=1 SV=1 376 493 2.0E-11
sp|Q7V6S2|KPRS_PROMM Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain MIT 9313) GN=prs PE=3 SV=1 382 493 2.0E-11
sp|Q97CA5|KPRS_THEVO Ribose-phosphate pyrophosphokinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=prs PE=1 SV=1 6 217 2.0E-11
sp|Q8ZU24|KPRS_PYRAE Ribose-phosphate pyrophosphokinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=prs PE=3 SV=1 28 219 2.0E-11
sp|Q9HVC5|KPRS_PSEAE Ribose-phosphate pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prs PE=3 SV=1 374 493 3.0E-11
sp|Q8TUT6|KPRS_METKA Ribose-phosphate pyrophosphokinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=prs PE=3 SV=1 5 216 5.0E-11
sp|Q82TQ4|KPRS_NITEU Ribose-phosphate pyrophosphokinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prs PE=3 SV=1 376 495 6.0E-11
sp|Q1LTH2|KPRS_BAUCH Ribose-phosphate pyrophosphokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prs PE=3 SV=1 380 495 6.0E-11
sp|Q8PNU0|KPRS_XANAC Ribose-phosphate pyrophosphokinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prs PE=3 SV=2 381 494 6.0E-11
sp|Q42581|KPRS1_ARATH Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Arabidopsis thaliana GN=PRS1 PE=2 SV=2 380 494 6.0E-11
sp|Q9D0M1|KPRA_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 382 493 7.0E-11
sp|Q14558|KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 382 493 8.0E-11
sp|O33924|KPRS_CORAM Ribose-phosphate pyrophosphokinase OS=Corynebacterium ammoniagenes GN=prs PE=3 SV=1 376 493 9.0E-11
sp|Q7VUH1|KPRS_BORPE Ribose-phosphate pyrophosphokinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prs PE=3 SV=2 380 493 9.0E-11
sp|Q08DW2|KPRA_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 382 493 1.0E-10
sp|Q899I8|KPRS_CLOTE Ribose-phosphate pyrophosphokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=prs PE=3 SV=1 376 493 1.0E-10
sp|Q81J97|KPRS_BACCR Ribose-phosphate pyrophosphokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prs PE=3 SV=1 376 493 1.0E-10
sp|Q81VZ0|KPRS_BACAN Ribose-phosphate pyrophosphokinase OS=Bacillus anthracis GN=prs PE=3 SV=1 376 493 1.0E-10
sp|Q9CEI4|KPRS2_LACLA Ribose-phosphate pyrophosphokinase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs2 PE=3 SV=1 363 495 1.0E-10
sp|Q82ZA5|KPRS2_ENTFA Ribose-phosphate pyrophosphokinase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs2 PE=3 SV=1 374 493 2.0E-10
sp|P75044|KPRS_MYCPN Ribose-phosphate pyrophosphokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prs PE=3 SV=3 382 493 2.0E-10
sp|Q7W181|KPRS_BORPA Ribose-phosphate pyrophosphokinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prs PE=3 SV=1 380 493 3.0E-10
sp|Q7WNY4|KPRS_BORBR Ribose-phosphate pyrophosphokinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prs PE=3 SV=1 380 493 3.0E-10
sp|Q55848|KPRS_SYNY3 Ribose-phosphate pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prs PE=3 SV=1 381 493 4.0E-10
sp|P47304|KPRS_MYCGE Ribose-phosphate pyrophosphokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prs PE=3 SV=2 382 493 4.0E-10
sp|Q9XG99|KPRS2_SPIOL Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Spinacia oleracea GN=PRS2 PE=2 SV=1 380 493 4.0E-10
sp|Q89DJ1|KPRS_BRADU Ribose-phosphate pyrophosphokinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prs PE=3 SV=2 376 493 6.0E-10
sp|Q9EWS0|KPRH_STRCO Putative ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0782 PE=3 SV=1 383 493 6.0E-10
sp|Q42583|KPRS2_ARATH Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Arabidopsis thaliana GN=PRS2 PE=2 SV=2 380 494 7.0E-10
sp|Q8RHM2|KPRS_FUSNN Ribose-phosphate pyrophosphokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prs PE=3 SV=1 376 493 1.0E-09
sp|Q9CHB8|KPRS1_LACLA Ribose-phosphate pyrophosphokinase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs1 PE=3 SV=1 381 495 1.0E-09
sp|Q6Z2L5|KPRS1_ORYSJ Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0127700 PE=2 SV=2 380 484 1.0E-09
sp|O52958|KPRS_THEKO Ribose-phosphate pyrophosphokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prs PE=1 SV=1 20 189 1.0E-09
sp|Q8Y2E1|KPRS_RALSO Ribose-phosphate pyrophosphokinase OS=Ralstonia solanacearum (strain GMI1000) GN=prs PE=3 SV=1 374 493 2.0E-09
sp|Q8PC63|KPRS_XANCP Ribose-phosphate pyrophosphokinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prs PE=3 SV=1 381 494 2.0E-09
sp|Q8G5P2|KPRS_BIFLO Ribose-phosphate pyrophosphokinase OS=Bifidobacterium longum (strain NCC 2705) GN=prs PE=3 SV=2 354 493 2.0E-09
sp|Q8U458|KPRS_PYRFU Ribose-phosphate pyrophosphokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prs PE=3 SV=1 5 214 2.0E-09
sp|Q9UY08|KPRS_PYRAB Ribose-phosphate pyrophosphokinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=prs PE=3 SV=2 29 196 2.0E-09
sp|Q0C5A1|KPRS_HYPNA Ribose-phosphate pyrophosphokinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=prs PE=3 SV=1 377 493 4.0E-09
sp|Q8DZK4|KPRS2_STRA5 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs2 PE=3 SV=1 384 498 5.0E-09
sp|Q8E568|KPRS2_STRA3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs2 PE=3 SV=1 384 498 5.0E-09
sp|O28853|KPRS2_ARCFU Ribose-phosphate pyrophosphokinase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prs2 PE=3 SV=1 11 216 8.0E-09
sp|P9WKE3|KPRS_MYCTU Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prs PE=1 SV=1 384 493 9.0E-09
sp|P9WKE2|KPRS_MYCTO Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prs PE=3 SV=1 384 493 9.0E-09
sp|P65233|KPRS_MYCBO Ribose-phosphate pyrophosphokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prs PE=3 SV=1 384 493 9.0E-09
sp|Q9AAV6|KPRS_CAUCR Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prs PE=3 SV=1 376 493 9.0E-09
sp|B8GZV1|KPRS_CAUCN Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prs PE=3 SV=1 376 493 9.0E-09
sp|Q69XQ6|KPRS2_ORYSJ Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0617800 PE=2 SV=2 380 493 1.0E-08
sp|Q9X1W3|KPRS_THEMA Ribose-phosphate pyrophosphokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prs PE=3 SV=1 380 493 2.0E-08
sp|Q8FZF0|KPRS_BRUSU Ribose-phosphate pyrophosphokinase OS=Brucella suis biovar 1 (strain 1330) GN=prs PE=3 SV=1 376 493 2.0E-08
sp|Q8NRU9|KPRS_CORGL Ribose-phosphate pyrophosphokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prs PE=3 SV=1 384 493 3.0E-08
sp|Q8DU94|KPRS2_STRMU Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs2 PE=3 SV=1 362 495 3.0E-08
sp|Q8YIG1|KPRS_BRUME Ribose-phosphate pyrophosphokinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prs PE=3 SV=2 376 493 4.0E-08
sp|Q88VA5|KPRS2_LACPL Ribose-phosphate pyrophosphokinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs2 PE=3 SV=1 374 493 4.0E-08
sp|O59586|KPRS_PYRHO Ribose-phosphate pyrophosphokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prs PE=3 SV=1 387 455 4.0E-08
sp|Q9XG98|KPRS1_SPIOL Ribose-phosphate pyrophosphokinase 1 OS=Spinacia oleracea GN=PRS1 PE=2 SV=1 380 493 5.0E-08
sp|Q8XHJ4|KPRS_CLOPE Ribose-phosphate pyrophosphokinase OS=Clostridium perfringens (strain 13 / Type A) GN=prs PE=3 SV=1 374 493 6.0E-08
sp|Q88Z84|KPRS1_LACPL Ribose-phosphate pyrophosphokinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs1 PE=3 SV=1 380 493 6.0E-08
sp|Q5XC85|KPRS2_STRP6 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs2 PE=1 SV=1 384 495 1.0E-07
sp|P0DC01|KPRS2_STRPQ Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs2 PE=3 SV=1 384 495 1.0E-07
sp|P0DC00|KPRS2_STRP3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs2 PE=3 SV=1 384 495 1.0E-07
sp|O52958|KPRS_THEKO Ribose-phosphate pyrophosphokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prs PE=1 SV=1 387 471 1.0E-07
sp|Q75JN8|PRPSB_DICDI Ribose-phosphate pyrophosphokinase B OS=Dictyostelium discoideum GN=prsB PE=3 SV=1 384 492 2.0E-07
sp|Q54QU9|PRPSC_DICDI Ribose-phosphate pyrophosphokinase C OS=Dictyostelium discoideum GN=prsC PE=3 SV=1 379 490 2.0E-07
sp|Q92EF1|KPRS2_LISIN Ribose-phosphate pyrophosphokinase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs2 PE=3 SV=1 376 493 2.0E-07
sp|B7IFM5|KPRS_THEAB Ribose-phosphate pyrophosphokinase OS=Thermosipho africanus (strain TCF52B) GN=prs PE=3 SV=1 380 493 3.0E-07
sp|Q92N73|KPRS_RHIME Ribose-phosphate pyrophosphokinase OS=Rhizobium meliloti (strain 1021) GN=prs PE=3 SV=1 376 493 3.0E-07
sp|Q9CD45|KPRS_MYCLE Ribose-phosphate pyrophosphokinase OS=Mycobacterium leprae (strain TN) GN=prs PE=3 SV=1 384 493 3.0E-07
sp|Q8P137|KPRS2_STRP8 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs2 PE=3 SV=1 384 493 3.0E-07
sp|Q8Y9L8|KPRS2_LISMO Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs2 PE=3 SV=1 376 493 3.0E-07
sp|Q723E1|KPRS2_LISMF Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs2 PE=3 SV=1 376 493 3.0E-07
sp|Q8U458|KPRS_PYRFU Ribose-phosphate pyrophosphokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prs PE=3 SV=1 387 455 3.0E-07
sp|Q99ZR0|KPRS2_STRP1 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M1 GN=prs2 PE=3 SV=1 384 495 4.0E-07
sp|Q0ARN5|KPRS_MARMM Ribose-phosphate pyrophosphokinase OS=Maricaulis maris (strain MCS10) GN=prs PE=3 SV=1 377 493 4.0E-07
sp|Q9K3U0|KPRS_STRCO Ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prs PE=3 SV=1 384 493 4.0E-07
sp|Q8CQU7|KPRS_STAES Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prs PE=3 SV=1 376 493 5.0E-07
sp|Q5HRQ5|KPRS_STAEQ Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prs PE=3 SV=1 376 493 5.0E-07
sp|Q832Z5|KPRS1_ENTFA Ribose-phosphate pyrophosphokinase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs1 PE=3 SV=1 363 493 5.0E-07
sp|O29666|KPRS1_ARCFU Ribose-phosphate pyrophosphokinase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prs1 PE=3 SV=2 5 133 5.0E-07
sp|Q5HIH5|KPRS_STAAC Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain COL) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|P65238|KPRS_STAAW Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|Q6GBY8|KPRS_STAAS Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|Q6GJH1|KPRS_STAAR Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|P65237|KPRS_STAAN Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=prs PE=1 SV=1 376 493 6.0E-07
sp|P65236|KPRS_STAAM Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|B9KPJ0|KPRS_RHOSK Ribose-phosphate pyrophosphokinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prs PE=3 SV=1 376 493 9.0E-07
sp|Q8FQV2|KPRS_COREF Ribose-phosphate pyrophosphokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prs PE=3 SV=1 384 493 1.0E-06
sp|O64888|KPRS5_ARATH Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PRS5 PE=2 SV=2 380 484 1.0E-06
sp|Q49V09|KPRS_STAS1 Ribose-phosphate pyrophosphokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=prs PE=3 SV=1 376 493 2.0E-06
sp|Q82HE7|KPRS_STRAW Ribose-phosphate pyrophosphokinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prs PE=3 SV=1 384 493 2.0E-06
sp|Q8DWM2|KPRS1_STRMU Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs1 PE=3 SV=1 367 496 3.0E-06
sp|Q9HN88|KPRS_HALSA Ribose-phosphate pyrophosphokinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=prs PE=3 SV=1 29 195 3.0E-06
sp|B0R7B4|KPRS_HALS3 Ribose-phosphate pyrophosphokinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=prs PE=3 SV=1 29 195 3.0E-06
sp|Q9KGJ5|KPRS_BACHD Ribose-phosphate pyrophosphokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prs PE=3 SV=1 376 493 4.0E-06
sp|Q7MT83|KPRS_PORGI Ribose-phosphate pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prs PE=3 SV=1 384 493 4.0E-06
sp|Q98HW3|KPRS_RHILO Ribose-phosphate pyrophosphokinase OS=Rhizobium loti (strain MAFF303099) GN=prs PE=3 SV=1 376 493 4.0E-06
sp|Q4L3F7|KPRS_STAHJ Ribose-phosphate pyrophosphokinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prs PE=3 SV=1 376 493 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009165 nucleotide biosynthetic process Yes
GO:0004749 ribose phosphate diphosphokinase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0006807 nitrogen compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016778 diphosphotransferase activity No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0090407 organophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1123
MRNTLIFAGNSCPVLTGQICQNLGTFPADAELTQFSNGETSVRILTSVREKDVFVVQSGSPRINDSIMELLIMIS
ACKGGSANKVTAVLPYFPYSRQSKKKSHRGAITARMLANLLGVAGVRHVITVDLHASQMQGFFKCPVDNLHAEPI
IAKWIRRNVPNWREAVVVSKNAGGTKRVTSLADALKLNFGMVTTDRKRGPSTTTSLIMNHLDVSERRTAPEYGAR
VSNEFDVESRPDKTPLRKPRILSNSRGSPTPRGRSSPPVSLEHGTSTVSHSKTPVRSIPSQPSDAEPQSPIDQVF
DDRRAQEVIHGRLVQGHIVADDFSPARSATEPSVAGDDPMTMSHASSFFAPEPQSLGGGGDAAVSSDEEDNAFRY
PGAEHMITLVGNVRNRTVFIVDDMIDKPGSWIAAAETVVKKGHAKKVYCIATHGVFGGDCLEQLQACECIDTIVV
TNSFPINHDRARNTSKLVILDLSFLLAEAIRRNHYGESISPLFLHTGD*
Coding >OphauB2|1123
ATGCGTAATACTCTTATATTCGCCGGCAATTCTTGCCCTGTTCTCACGGGCCAGATCTGCCAGAATCTGGGCACG
TTCCCCGCAGACGCGGAACTCACCCAATTCTCCAACGGCGAAACGAGTGTCAGGATTCTCACCAGCGTTCGAGAA
AAAGACGTCTTCGTCGTTCAGTCGGGCAGCCCCCGCATCAATGACTCCATCATGGAGCTTCTCATCATGATCTCG
GCTTGTAAAGGAGGCTCGGCCAACAAGGTCACAGCCGTCTTGCCTTATTTCCCATATAGTCGTCAGTCCAAGAAG
AAGTCGCACAGAGGCGCCATCACAGCTCGCATGCTGGCAAATCTTCTCGGTGTGGCCGGCGTTAGACACGTCATC
ACCGTTGATCTCCATGCATCGCAGATGCAGGGCTTCTTCAAATGTCCCGTAGACAATCTACATGCCGAGCCCATC
ATCGCAAAATGGATACGGCGCAACGTCCCCAACTGGCGCGAGGCCGTTGTTGTTTCAAAGAATGCTGGGGGCACC
AAGCGTGTCACCTCGCTCGCTGATGCACTCAAGCTCAACTTTGGCATGGTGACGACGGATCGCAAGCGAGGACCA
AGTACAACAACTAGCTTGATTATGAATCACCTAGATGTCTCTGAACGCCGAACAGCTCCGGAGTATGGAGCTCGC
GTGTCGAATGAATTCGACGTGGAATCACGGCCTGACAAGACTCCACTTCGAAAACCCAGGATATTATCAAATTCG
AGAGGCTCACCAACGCCACGCGGTAGAAGTTCACCGCCAGTATCCCTGGAACATGGCACATCGACTGTCTCACAT
TCCAAGACCCCTGTTCGATCAATACCTAGCCAGCCGTCAGACGCAGAGCCTCAGTCTCCCATAGACCAGGTATTT
GACGATCGGCGTGCCCAAGAGGTTATCCATGGCCGTCTAGTCCAAGGCCACATTGTTGCAGACGACTTTTCGCCC
GCAAGGTCAGCGACCGAACCTAGTGTTGCAGGAGACGACCCCATGACCATGTCACATGCTTCATCATTCTTCGCG
CCAGAACCGCAGTCTCTGGGGGGCGGTGGTGATGCAGCAGTCAGCTCAGACGAAGAGGATAATGCGTTTCGTTAT
CCAGGAGCCGAGCATATGATTACCCTTGTCGGAAATGTGCGGAATAGGACTGTCTTCATCGTGGATGACATGATA
GACAAACCGGGTTCGTGGATCGCCGCAGCCGAGACAGTAGTCAAAAAGGGCCATGCTAAAAAGGTATACTGCATT
GCTACCCACGGAGTCTTTGGTGGGGACTGTCTAGAGCAATTACAAGCATGTGAGTGCATCGACACCATAGTGGTC
ACCAACAGCTTCCCCATCAATCACGACCGTGCCCGAAACACGAGCAAGTTGGTCATTCTAGACTTGTCTTTTCTT
TTGGCTGAAGCAATTCGTCGCAACCATTATGGCGAGTCTATATCTCCATTGTTTCTACACACTGGAGATTAG
Transcript >OphauB2|1123
ATGCGTAATACTCTTATATTCGCCGGCAATTCTTGCCCTGTTCTCACGGGCCAGATCTGCCAGAATCTGGGCACG
TTCCCCGCAGACGCGGAACTCACCCAATTCTCCAACGGCGAAACGAGTGTCAGGATTCTCACCAGCGTTCGAGAA
AAAGACGTCTTCGTCGTTCAGTCGGGCAGCCCCCGCATCAATGACTCCATCATGGAGCTTCTCATCATGATCTCG
GCTTGTAAAGGAGGCTCGGCCAACAAGGTCACAGCCGTCTTGCCTTATTTCCCATATAGTCGTCAGTCCAAGAAG
AAGTCGCACAGAGGCGCCATCACAGCTCGCATGCTGGCAAATCTTCTCGGTGTGGCCGGCGTTAGACACGTCATC
ACCGTTGATCTCCATGCATCGCAGATGCAGGGCTTCTTCAAATGTCCCGTAGACAATCTACATGCCGAGCCCATC
ATCGCAAAATGGATACGGCGCAACGTCCCCAACTGGCGCGAGGCCGTTGTTGTTTCAAAGAATGCTGGGGGCACC
AAGCGTGTCACCTCGCTCGCTGATGCACTCAAGCTCAACTTTGGCATGGTGACGACGGATCGCAAGCGAGGACCA
AGTACAACAACTAGCTTGATTATGAATCACCTAGATGTCTCTGAACGCCGAACAGCTCCGGAGTATGGAGCTCGC
GTGTCGAATGAATTCGACGTGGAATCACGGCCTGACAAGACTCCACTTCGAAAACCCAGGATATTATCAAATTCG
AGAGGCTCACCAACGCCACGCGGTAGAAGTTCACCGCCAGTATCCCTGGAACATGGCACATCGACTGTCTCACAT
TCCAAGACCCCTGTTCGATCAATACCTAGCCAGCCGTCAGACGCAGAGCCTCAGTCTCCCATAGACCAGGTATTT
GACGATCGGCGTGCCCAAGAGGTTATCCATGGCCGTCTAGTCCAAGGCCACATTGTTGCAGACGACTTTTCGCCC
GCAAGGTCAGCGACCGAACCTAGTGTTGCAGGAGACGACCCCATGACCATGTCACATGCTTCATCATTCTTCGCG
CCAGAACCGCAGTCTCTGGGGGGCGGTGGTGATGCAGCAGTCAGCTCAGACGAAGAGGATAATGCGTTTCGTTAT
CCAGGAGCCGAGCATATGATTACCCTTGTCGGAAATGTGCGGAATAGGACTGTCTTCATCGTGGATGACATGATA
GACAAACCGGGTTCGTGGATCGCCGCAGCCGAGACAGTAGTCAAAAAGGGCCATGCTAAAAAGGTATACTGCATT
GCTACCCACGGAGTCTTTGGTGGGGACTGTCTAGAGCAATTACAAGCATGTGAGTGCATCGACACCATAGTGGTC
ACCAACAGCTTCCCCATCAATCACGACCGTGCCCGAAACACGAGCAAGTTGGTCATTCTAGACTTGTCTTTTCTT
TTGGCTGAAGCAATTCGTCGCAACCATTATGGCGAGTCTATATCTCCATTGTTTCTACACACTGGAGATTAG
Gene >OphauB2|1123
ATGCGTAATACTCTTATATTCGCCGGCAATTCTTGCCCTGTTCTCACGGGCCAGATCTGCCAGAATCTGGGCACG
TTCCCCGCAGACGCGGAACTCACCCAATTCTCCAACGTGAGTGAGCGCCCCTACGTCTTGCAACACAAGGAGGCA
GAACTGCCTACCTGGCAGGTAGTAGCTGCCAAGCTGCGCCTTGTAATGCTATGAGGCAGGCCTGGCCGTTTCGCC
CTTTTGCTTGCATGGTGCCAATCTAATAGCAAGTCGTGCTGCTCAAGGGCGAAACGAGTGTCAGGATTCTCACCA
GCGTTCGAGAAAAAGACGTCTTCGTCGTTCAGTCGGGCAGCCCCCGCATCAATGACTCCATCATGGAGCTTCTCA
TCATGATCTCGGCTTGTAAAGGAGGCTCGGCCAACAAGGTCACAGGTCAGTCTTGCCCAGCTCCTTGGTCATGAG
GCCAAGGTGATTAATTATTTCCCTGCTGCAGCCGTCTTGCCTTATTTCCCATATAGTCGTCAGTCCAAGAAGAAG
TCGCACAGAGGCGCCATCACAGCTCGCATGCTGGCAAATCTTCTCGGTGTGGCCGGCGTTAGACACGTCATCACC
GTTGATCTCCATGCATCGCAGATGCAGGGCTTCTTCAAATGTCCCGTAGACAATCTACATGCCGAGCCCATCATC
GCAAAATGGATACGGCGCAACGTCCCCAACTGGCGCGAGGCCGTTGTTGTTTCAAAGAATGCTGGGGGCACCAAG
CGTGTCACCTCGCTCGCTGATGCACTCAAGCTCAACTTTGGCATGGTGACGACGGATCGCAAGCGAGGACCAAGT
ACAACAACTAGCTTGATTATGAATCACCTAGATGTCTCTGAACGCCGAACAGCTCCGGAGTATGGAGCTCGCGTG
TCGAATGAATTCGACGTGGAATCACGGCCTGACAAGACTCCACTTCGAAAACCCAGGATATTATCAAATTCGAGA
GGCTCACCAACGCCACGCGGTAGAAGTTCACCGCCAGTATCCCTGGAACATGGCACATCGACTGTCTCACATTCC
AAGACCCCTGTTCGATCAATACCTAGCCAGCCGTCAGACGCAGAGCCTCAGTCTCCCATAGACCAGGTATTTGAC
GATCGGCGTGCCCAAGAGGTTATCCATGGCCGTCTAGTCCAAGGCCACATTGTTGCAGACGACTTTTCGCCCGCA
AGGTCAGCGACCGAACCTAGTGTTGCAGGAGACGACCCCATGACCATGTCACATGCTTCATCATTCTTCGCGCCA
GAACCGCAGTCTCTGGGGGGCGGTGGTGATGCAGCAGTCAGCTCAGACGAAGAGGATAATGCGTTTCGTTATCCA
GGAGCCGAGCATATGATTACCCTTGTCGGAAATGTGCGGAATAGGACTGTCTTCATCGTGGATGACATGATAGAC
AAACCGGGTTCGTGGATCGCCGCAGCCGAGACAGTAGTCAAAAAGGGCCATGCTAAAAAGGTATACTGCATTGCT
ACCCACGGAGTCTTTGGTGGGGACTGTCTAGAGCAATTACAAGCATGTGAGTGCATCGACACCATAGTGGTCACC
AACAGCTTCCCCATCAATCACGACCGTGCCCGAAACACGAGCAAGTTGGTCATTCTAGACTTGTCTTTTCTTTTG
GCTGAAGCAATTCGTCGCAACCATTATGGCGAGTCTATATCTCCATTGTTTCTACACACTGGAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail