Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1123
Gene name
LocationContig_127:27367..29086
Strand-
Gene length (bp)1719
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase 3.1E-40 5 120
PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain 3.0E-26 381 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32895|KPR1_YEAST Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 1 198 3.0E-86
sp|P41831|KPR1_SCHPO Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 1 215 9.0E-86
sp|P21108|PRPS3_HUMAN Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 1 216 5.0E-68
sp|Q5XGI0|PRPS2_XENTR Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 1 216 4.0E-67
sp|Q7ZXC9|PRPS2_XENLA Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 1 216 2.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32895|KPR1_YEAST Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 1 198 3.0E-86
sp|P41831|KPR1_SCHPO Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 1 215 9.0E-86
sp|P21108|PRPS3_HUMAN Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 1 216 5.0E-68
sp|Q5XGI0|PRPS2_XENTR Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 1 216 4.0E-67
sp|Q7ZXC9|PRPS2_XENLA Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 1 216 2.0E-66
sp|Q4R4U3|PRPS1_MACFA Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis GN=PRPS1 PE=2 SV=1 1 216 4.0E-66
sp|P60892|PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus GN=Prps1 PE=1 SV=2 1 216 5.0E-66
sp|Q5RFJ7|PRPS1_PONAB Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii GN=PRPS1 PE=2 SV=1 1 216 5.0E-66
sp|Q9D7G0|PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus GN=Prps1 PE=1 SV=4 1 216 5.0E-66
sp|P60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens GN=PRPS1 PE=1 SV=2 1 216 5.0E-66
sp|Q2HJ58|PRPS1_BOVIN Ribose-phosphate pyrophosphokinase 1 OS=Bos taurus GN=PRPS1 PE=2 SV=3 1 216 5.0E-66
sp|Q9CS42|PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus GN=Prps2 PE=1 SV=4 1 216 8.0E-66
sp|P09330|PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus GN=Prps2 PE=1 SV=3 1 216 9.0E-66
sp|Q5R8F8|PRPS2_PONAB Ribose-phosphate pyrophosphokinase 2 OS=Pongo abelii GN=PRPS2 PE=2 SV=1 1 216 3.0E-65
sp|Q4R4R7|PRPS2_MACFA Ribose-phosphate pyrophosphokinase 2 OS=Macaca fascicularis GN=PRPS2 PE=2 SV=3 1 216 3.0E-65
sp|P11908|PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens GN=PRPS2 PE=1 SV=2 1 216 3.0E-65
sp|Q5ZI49|PRPS2_CHICK Ribose-phosphate pyrophosphokinase 2 OS=Gallus gallus GN=PRPS2 PE=2 SV=1 1 216 1.0E-61
sp|O94413|KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.06c PE=1 SV=1 6 199 2.0E-61
sp|P38063|KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS4 PE=1 SV=3 6 208 3.0E-58
sp|P38620|KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS2 PE=1 SV=1 6 208 2.0E-57
sp|P87171|KPR5_SCHPO Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 1 207 3.0E-56
sp|Q54PA9|PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum GN=prsA PE=1 SV=1 6 199 5.0E-52
sp|P46585|KPR1_CANAX Ribose-phosphate pyrophosphokinase 1 OS=Candida albicans GN=PRS1 PE=3 SV=1 15 216 1.0E-51
sp|P38689|KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS3 PE=1 SV=1 15 216 7.0E-51
sp|O08618|KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=1 SV=1 5 192 3.0E-47
sp|O60256|KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens GN=PRPSAP2 PE=1 SV=1 5 192 3.0E-47
sp|Q5RBA8|KPRB_PONAB Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 5 192 3.0E-47
sp|Q8R574|KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 5 192 3.0E-47
sp|Q5ZL26|KPRB_CHICK Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 5 192 4.0E-47
sp|A2VDS0|KPRB_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 5 192 2.0E-46
sp|Q28DH0|KPRB_XENTR Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 5 192 2.0E-46
sp|Q97E93|KPRS_CLOAB Ribose-phosphate pyrophosphokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prs PE=3 SV=1 2 209 5.0E-46
sp|Q8XHJ4|KPRS_CLOPE Ribose-phosphate pyrophosphokinase OS=Clostridium perfringens (strain 13 / Type A) GN=prs PE=3 SV=1 2 216 5.0E-46
sp|Q14558|KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 6 209 1.0E-45
sp|Q08DW2|KPRA_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 6 192 1.0E-45
sp|Q9D0M1|KPRA_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 6 209 1.0E-45
sp|Q8RHM2|KPRS_FUSNN Ribose-phosphate pyrophosphokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prs PE=3 SV=1 3 219 1.0E-45
sp|B7IFM5|KPRS_THEAB Ribose-phosphate pyrophosphokinase OS=Thermosipho africanus (strain TCF52B) GN=prs PE=3 SV=1 6 219 2.0E-45
sp|Q63468|KPRA_RAT Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 6 209 3.0E-45
sp|Q8R753|KPRS_CALS4 Ribose-phosphate pyrophosphokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prs PE=3 SV=1 6 209 1.0E-44
sp|Q8Y2E1|KPRS_RALSO Ribose-phosphate pyrophosphokinase OS=Ralstonia solanacearum (strain GMI1000) GN=prs PE=3 SV=1 5 217 1.0E-44
sp|Q7M8J0|KPRS_WOLSU Ribose-phosphate pyrophosphokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prs PE=3 SV=1 1 209 3.0E-44
sp|Q8EZN0|KPRS_LEPIN Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prs PE=3 SV=1 6 209 5.0E-44
sp|Q72V73|KPRS_LEPIC Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prs PE=3 SV=1 6 209 6.0E-44
sp|P56184|KPRS_HELPY Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prs PE=3 SV=1 1 217 9.0E-44
sp|Q9X1W3|KPRS_THEMA Ribose-phosphate pyrophosphokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prs PE=3 SV=1 6 209 1.0E-43
sp|Q9ZLA1|KPRS_HELPJ Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prs PE=3 SV=1 1 217 1.0E-43
sp|Q75JN8|PRPSB_DICDI Ribose-phosphate pyrophosphokinase B OS=Dictyostelium discoideum GN=prsB PE=3 SV=1 5 192 2.0E-43
sp|Q92N73|KPRS_RHIME Ribose-phosphate pyrophosphokinase OS=Rhizobium meliloti (strain 1021) GN=prs PE=3 SV=1 6 207 3.0E-43
sp|Q7NQS9|KPRS_CHRVO Ribose-phosphate pyrophosphokinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prs PE=3 SV=1 5 216 3.0E-43
sp|P65240|KPRS1_STRR6 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs1 PE=3 SV=1 6 218 5.0E-43
sp|P65239|KPRS1_STRPN Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs1 PE=3 SV=1 6 218 5.0E-43
sp|Q9PP15|KPRS_CAMJE Ribose-phosphate pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prs PE=3 SV=1 1 218 5.0E-43
sp|P32895|KPR1_YEAST Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 343 493 1.0E-42
sp|Q8EU34|KPRS_OCEIH Ribose-phosphate pyrophosphokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prs PE=3 SV=1 6 219 1.0E-42
sp|Q6AJL7|KPRS_DESPS Ribose-phosphate pyrophosphokinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prs PE=3 SV=1 6 198 1.0E-42
sp|Q899I8|KPRS_CLOTE Ribose-phosphate pyrophosphokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=prs PE=3 SV=1 6 209 2.0E-42
sp|Q8YIG1|KPRS_BRUME Ribose-phosphate pyrophosphokinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prs PE=3 SV=2 6 207 3.0E-42
sp|Q8FZF0|KPRS_BRUSU Ribose-phosphate pyrophosphokinase OS=Brucella suis biovar 1 (strain 1330) GN=prs PE=3 SV=1 6 207 3.0E-42
sp|P42816|KPRS_BACCL Ribose-phosphate pyrophosphokinase OS=Bacillus caldolyticus GN=prs PE=3 SV=1 6 209 4.0E-42
sp|Q7UPM4|KPRS_RHOBA Ribose-phosphate pyrophosphokinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=prs PE=3 SV=1 1 198 4.0E-42
sp|Q9KQ22|KPRS_VIBCH Ribose-phosphate pyrophosphokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prs PE=3 SV=1 1 216 5.0E-42
sp|Q54QU9|PRPSC_DICDI Ribose-phosphate pyrophosphokinase C OS=Dictyostelium discoideum GN=prsC PE=3 SV=1 1 197 8.0E-42
sp|P14193|KPRS_BACSU Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=prs PE=1 SV=1 2 219 8.0E-42
sp|Q9KGJ5|KPRS_BACHD Ribose-phosphate pyrophosphokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prs PE=3 SV=1 3 219 1.0E-41
sp|Q81J97|KPRS_BACCR Ribose-phosphate pyrophosphokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prs PE=3 SV=1 3 219 2.0E-41
sp|Q81VZ0|KPRS_BACAN Ribose-phosphate pyrophosphokinase OS=Bacillus anthracis GN=prs PE=3 SV=1 3 219 2.0E-41
sp|Q8ZEY2|KPRS_YERPE Ribose-phosphate pyrophosphokinase OS=Yersinia pestis GN=prs PE=3 SV=1 1 216 2.0E-41
sp|O33924|KPRS_CORAM Ribose-phosphate pyrophosphokinase OS=Corynebacterium ammoniagenes GN=prs PE=3 SV=1 3 219 2.0E-41
sp|P0DB99|KPRS1_STRPQ Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|P65245|KPRS1_STRP8 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|Q5XEL0|KPRS1_STRP6 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs1 PE=3 SV=2 6 209 2.0E-41
sp|P0DB98|KPRS1_STRP3 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|P65243|KPRS1_STRP1 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M1 GN=prs1 PE=3 SV=1 6 209 2.0E-41
sp|P44328|KPRS_HAEIN Ribose-phosphate pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prs PE=3 SV=1 1 216 2.0E-41
sp|Q9HVC5|KPRS_PSEAE Ribose-phosphate pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prs PE=3 SV=1 1 218 3.0E-41
sp|Q8DWM2|KPRS1_STRMU Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs1 PE=3 SV=1 3 209 4.0E-41
sp|Q9RUD2|KPRS_DEIRA Ribose-phosphate pyrophosphokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=prs PE=3 SV=2 5 198 4.0E-41
sp|P0A717|KPRS_ECOLI Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) GN=prs PE=1 SV=2 1 216 5.0E-41
sp|P0A718|KPRS_ECOL6 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prs PE=3 SV=2 1 216 5.0E-41
sp|P0A719|KPRS_ECO57 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O157:H7 GN=prs PE=3 SV=2 1 216 5.0E-41
sp|P0A1V6|KPRS_SALTY Ribose-phosphate pyrophosphokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prs PE=3 SV=2 1 216 6.0E-41
sp|P0A1V7|KPRS_SALTI Ribose-phosphate pyrophosphokinase OS=Salmonella typhi GN=prs PE=3 SV=2 1 216 6.0E-41
sp|Q87RN8|KPRS_VIBPA Ribose-phosphate pyrophosphokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prs PE=3 SV=1 1 216 8.0E-41
sp|Q82ZA5|KPRS2_ENTFA Ribose-phosphate pyrophosphokinase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs2 PE=3 SV=1 6 218 9.0E-41
sp|Q7MMZ1|KPRS_VIBVY Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain YJ016) GN=prs PE=3 SV=1 1 216 1.0E-40
sp|Q8DFF5|KPRS_VIBVU Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain CMCP6) GN=prs PE=3 SV=2 1 216 1.0E-40
sp|P9WKE3|KPRS_MYCTU Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prs PE=1 SV=1 2 216 1.0E-40
sp|P9WKE2|KPRS_MYCTO Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prs PE=3 SV=1 2 216 1.0E-40
sp|P65233|KPRS_MYCBO Ribose-phosphate pyrophosphokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prs PE=3 SV=1 2 216 1.0E-40
sp|Q8E2H0|KPRS1_STRA5 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs1 PE=3 SV=1 3 209 1.0E-40
sp|Q8E7X8|KPRS1_STRA3 Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs1 PE=3 SV=1 3 209 1.0E-40
sp|Q7MT83|KPRS_PORGI Ribose-phosphate pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prs PE=3 SV=1 3 185 1.0E-40
sp|Q7W181|KPRS_BORPA Ribose-phosphate pyrophosphokinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prs PE=3 SV=1 5 218 2.0E-40
sp|Q7WNY4|KPRS_BORBR Ribose-phosphate pyrophosphokinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prs PE=3 SV=1 5 218 2.0E-40
sp|Q8UDA9|KPRS_AGRFC Ribose-phosphate pyrophosphokinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=prs PE=3 SV=2 6 207 2.0E-40
sp|Q98HW3|KPRS_RHILO Ribose-phosphate pyrophosphokinase OS=Rhizobium loti (strain MAFF303099) GN=prs PE=3 SV=1 6 207 3.0E-40
sp|Q88PX6|KPRS_PSEPK Ribose-phosphate pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=prs PE=3 SV=1 1 199 3.0E-40
sp|P65235|KPRS_NEIMB Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=prs PE=1 SV=1 5 218 3.0E-40
sp|P65234|KPRS_NEIMA Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prs PE=3 SV=1 5 218 3.0E-40
sp|Q7N590|KPRS_PHOLL Ribose-phosphate pyrophosphokinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prs PE=3 SV=1 1 216 3.0E-40
sp|Q888C6|KPRS_PSESM Ribose-phosphate pyrophosphokinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prs PE=3 SV=1 1 199 3.0E-40
sp|Q7VUH1|KPRS_BORPE Ribose-phosphate pyrophosphokinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prs PE=3 SV=2 5 218 4.0E-40
sp|Q82TQ4|KPRS_NITEU Ribose-phosphate pyrophosphokinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prs PE=3 SV=1 5 209 5.0E-40
sp|Q8KCQ2|KPRS_CHLTE Ribose-phosphate pyrophosphokinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prs PE=3 SV=1 6 209 6.0E-40
sp|Q7VL55|KPRS_HAEDU Ribose-phosphate pyrophosphokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prs PE=3 SV=1 1 216 8.0E-40
sp|Q5HIH5|KPRS_STAAC Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain COL) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|P65238|KPRS_STAAW Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|Q6GBY8|KPRS_STAAS Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|Q6GJH1|KPRS_STAAR Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|P65237|KPRS_STAAN Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=prs PE=1 SV=1 6 219 1.0E-39
sp|P65236|KPRS_STAAM Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prs PE=3 SV=1 6 219 1.0E-39
sp|Q1LTH2|KPRS_BAUCH Ribose-phosphate pyrophosphokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prs PE=3 SV=1 6 216 1.0E-39
sp|Q7VR76|KPRS_BLOFL Ribose-phosphate pyrophosphokinase OS=Blochmannia floridanus GN=prs PE=3 SV=1 6 216 2.0E-39
sp|Q8K9X2|KPRS_BUCAP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prs PE=3 SV=1 1 216 2.0E-39
sp|Q8PNU0|KPRS_XANAC Ribose-phosphate pyrophosphokinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prs PE=3 SV=2 2 209 3.0E-39
sp|Q9CD45|KPRS_MYCLE Ribose-phosphate pyrophosphokinase OS=Mycobacterium leprae (strain TN) GN=prs PE=3 SV=1 2 185 4.0E-39
sp|Q9CHB8|KPRS1_LACLA Ribose-phosphate pyrophosphokinase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs1 PE=3 SV=1 3 209 4.0E-39
sp|Q9CEI4|KPRS2_LACLA Ribose-phosphate pyrophosphokinase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs2 PE=3 SV=1 6 192 4.0E-39
sp|Q9PA76|KPRS_XYLFA Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain 9a5c) GN=prs PE=3 SV=2 2 209 6.0E-39
sp|Q87A22|KPRS_XYLFT Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prs PE=3 SV=1 2 209 6.0E-39
sp|Q7VFY9|KPRS_HELHP Ribose-phosphate pyrophosphokinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prs PE=3 SV=1 1 212 6.0E-39
sp|Q9CP22|KPRS_PASMU Ribose-phosphate pyrophosphokinase OS=Pasteurella multocida (strain Pm70) GN=prs PE=3 SV=1 1 216 6.0E-39
sp|O67556|KPRS_AQUAE Ribose-phosphate pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=prs PE=3 SV=1 1 209 6.0E-39
sp|Q9AAV6|KPRS_CAUCR Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prs PE=3 SV=1 6 217 7.0E-39
sp|B8GZV1|KPRS_CAUCN Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prs PE=3 SV=1 6 217 7.0E-39
sp|Q49V09|KPRS_STAS1 Ribose-phosphate pyrophosphokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=prs PE=3 SV=1 6 219 7.0E-39
sp|Q8CQU7|KPRS_STAES Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prs PE=3 SV=1 6 219 7.0E-39
sp|Q5HRQ5|KPRS_STAEQ Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prs PE=3 SV=1 6 219 7.0E-39
sp|P57266|KPRS_BUCAI Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prs PE=3 SV=1 1 216 7.0E-39
sp|Q4L3F7|KPRS_STAHJ Ribose-phosphate pyrophosphokinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prs PE=3 SV=1 6 219 8.0E-39
sp|Q8PC63|KPRS_XANCP Ribose-phosphate pyrophosphokinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prs PE=3 SV=1 2 209 8.0E-39
sp|Q8FQV2|KPRS_COREF Ribose-phosphate pyrophosphokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prs PE=3 SV=1 2 185 9.0E-39
sp|A6W1C7|KPRS_MARMS Ribose-phosphate pyrophosphokinase OS=Marinomonas sp. (strain MWYL1) GN=prs PE=3 SV=1 1 218 9.0E-39
sp|Q7VBH4|KPRS_PROMA Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=prs PE=3 SV=1 6 199 1.0E-38
sp|Q89DJ1|KPRS_BRADU Ribose-phosphate pyrophosphokinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prs PE=3 SV=2 6 207 2.0E-38
sp|Q88Z84|KPRS1_LACPL Ribose-phosphate pyrophosphokinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs1 PE=3 SV=1 6 217 2.0E-38
sp|Q7NM67|KPRS_GLOVI Ribose-phosphate pyrophosphokinase OS=Gloeobacter violaceus (strain PCC 7421) GN=prs PE=3 SV=1 6 219 2.0E-38
sp|Q99ZR0|KPRS2_STRP1 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M1 GN=prs2 PE=3 SV=1 34 199 2.0E-38
sp|Q8EAQ9|KPRS_SHEON Ribose-phosphate pyrophosphokinase OS=Shewanella oneidensis (strain MR-1) GN=prs PE=3 SV=1 1 216 4.0E-38
sp|Q8NRU9|KPRS_CORGL Ribose-phosphate pyrophosphokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prs PE=3 SV=1 2 185 5.0E-38
sp|Q0BPP0|KPRS_GRABC Ribose-phosphate pyrophosphokinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prs PE=3 SV=1 6 199 8.0E-38
sp|Q0ARN5|KPRS_MARMM Ribose-phosphate pyrophosphokinase OS=Maricaulis maris (strain MCS10) GN=prs PE=3 SV=1 6 217 8.0E-38
sp|P65242|KPRS2_STRR6 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs2 PE=3 SV=1 2 185 9.0E-38
sp|P65241|KPRS2_STRPN Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs2 PE=3 SV=1 2 185 9.0E-38
sp|Q5XC85|KPRS2_STRP6 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs2 PE=1 SV=1 34 199 1.0E-37
sp|Q7V6S2|KPRS_PROMM Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain MIT 9313) GN=prs PE=3 SV=1 1 206 1.0E-37
sp|Q8DZK4|KPRS2_STRA5 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs2 PE=3 SV=1 34 199 1.0E-37
sp|Q8E568|KPRS2_STRA3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs2 PE=3 SV=1 34 199 1.0E-37
sp|Q55848|KPRS_SYNY3 Ribose-phosphate pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prs PE=3 SV=1 6 219 2.0E-37
sp|P47304|KPRS_MYCGE Ribose-phosphate pyrophosphokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prs PE=3 SV=2 2 211 2.0E-37
sp|P0DC01|KPRS2_STRPQ Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs2 PE=3 SV=1 34 199 3.0E-37
sp|P0DC00|KPRS2_STRP3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs2 PE=3 SV=1 34 199 3.0E-37
sp|Q6Z2L5|KPRS1_ORYSJ Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0127700 PE=2 SV=2 6 198 4.0E-37
sp|Q0C5A1|KPRS_HYPNA Ribose-phosphate pyrophosphokinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=prs PE=3 SV=1 15 209 4.0E-37
sp|Q88VA5|KPRS2_LACPL Ribose-phosphate pyrophosphokinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs2 PE=3 SV=1 6 185 1.0E-36
sp|Q832Z5|KPRS1_ENTFA Ribose-phosphate pyrophosphokinase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs1 PE=3 SV=1 6 199 1.0E-36
sp|Q8P137|KPRS2_STRP8 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs2 PE=3 SV=1 34 199 1.0E-36
sp|Q7V111|KPRS_PROMP Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=prs PE=3 SV=1 6 198 1.0E-36
sp|P75044|KPRS_MYCPN Ribose-phosphate pyrophosphokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prs PE=3 SV=3 3 198 1.0E-36
sp|P59512|KPRS_BUCBP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=prs PE=3 SV=1 1 209 1.0E-36
sp|O64888|KPRS5_ARATH Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PRS5 PE=2 SV=2 6 198 2.0E-36
sp|Q9XG98|KPRS1_SPIOL Ribose-phosphate pyrophosphokinase 1 OS=Spinacia oleracea GN=PRS1 PE=2 SV=1 6 198 2.0E-36
sp|Q8DU94|KPRS2_STRMU Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs2 PE=3 SV=1 6 185 2.0E-36
sp|Q7U7L5|KPRS_SYNPX Ribose-phosphate pyrophosphokinase OS=Synechococcus sp. (strain WH8102) GN=prs PE=3 SV=1 2 206 2.0E-36
sp|Q83TK1|KPRS_LISWE Ribose-phosphate pyrophosphokinase OS=Listeria welshimeri GN=prs PE=3 SV=1 6 209 2.0E-36
sp|Q83YI7|KPRS_LISIV Ribose-phosphate pyrophosphokinase OS=Listeria ivanovii GN=prs PE=3 SV=1 6 209 2.0E-36
sp|Q92F68|KPRS1_LISIN Ribose-phosphate pyrophosphokinase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs1 PE=3 SV=1 6 209 2.0E-36
sp|Q48793|KPRS1_LISMO Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs1 PE=3 SV=1 6 209 2.0E-36
sp|Q724L4|KPRS1_LISMF Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs1 PE=3 SV=1 6 209 2.0E-36
sp|Q59988|KPRS_SYNE7 Ribose-phosphate pyrophosphokinase OS=Synechococcus elongatus (strain PCC 7942) GN=prs PE=3 SV=1 6 198 4.0E-36
sp|Q8Y9L8|KPRS2_LISMO Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs2 PE=3 SV=1 6 200 8.0E-36
sp|Q42583|KPRS2_ARATH Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Arabidopsis thaliana GN=PRS2 PE=2 SV=2 6 198 1.0E-35
sp|Q9XG99|KPRS2_SPIOL Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Spinacia oleracea GN=PRS2 PE=2 SV=1 6 198 1.0E-35
sp|Q723E1|KPRS2_LISMF Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs2 PE=3 SV=1 6 200 1.0E-35
sp|Q8YN97|KPRS_NOSS1 Ribose-phosphate pyrophosphokinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prs PE=3 SV=1 6 219 5.0E-35
sp|Q92EF1|KPRS2_LISIN Ribose-phosphate pyrophosphokinase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs2 PE=3 SV=1 6 200 9.0E-35
sp|Q42581|KPRS1_ARATH Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Arabidopsis thaliana GN=PRS1 PE=2 SV=2 6 198 9.0E-35
sp|Q82HE7|KPRS_STRAW Ribose-phosphate pyrophosphokinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prs PE=3 SV=1 2 198 1.0E-34
sp|B9KPJ0|KPRS_RHOSK Ribose-phosphate pyrophosphokinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prs PE=3 SV=1 29 198 6.0E-34
sp|Q9K3U0|KPRS_STRCO Ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prs PE=3 SV=1 2 198 7.0E-34
sp|Q69XQ6|KPRS2_ORYSJ Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0617800 PE=2 SV=2 6 198 8.0E-34
sp|Q8G5P2|KPRS_BIFLO Ribose-phosphate pyrophosphokinase OS=Bifidobacterium longum (strain NCC 2705) GN=prs PE=3 SV=2 2 173 8.0E-33
sp|Q83AQ1|KPRS_COXBU Ribose-phosphate pyrophosphokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prs PE=3 SV=1 6 209 2.0E-32
sp|P41831|KPR1_SCHPO Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 309 493 1.0E-31
sp|Q98R83|KPRS_MYCPU Ribose-phosphate pyrophosphokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prs PE=3 SV=1 4 207 1.0E-31
sp|Q9EWS0|KPRH_STRCO Putative ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0782 PE=3 SV=1 1 185 1.0E-31
sp|Q12265|KPR5_YEAST Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 1 97 4.0E-28
sp|Q9PQV0|KPRS_UREPA Ribose-phosphate pyrophosphokinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=prs PE=3 SV=1 3 198 1.0E-26
sp|Q12265|KPR5_YEAST Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 111 216 1.0E-21
sp|Q4R4U3|PRPS1_MACFA Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis GN=PRPS1 PE=2 SV=1 382 496 4.0E-21
sp|P60892|PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus GN=Prps1 PE=1 SV=2 382 496 4.0E-21
sp|Q5RFJ7|PRPS1_PONAB Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii GN=PRPS1 PE=2 SV=1 382 496 4.0E-21
sp|Q9D7G0|PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus GN=Prps1 PE=1 SV=4 382 496 4.0E-21
sp|P60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens GN=PRPS1 PE=1 SV=2 382 496 4.0E-21
sp|Q2HJ58|PRPS1_BOVIN Ribose-phosphate pyrophosphokinase 1 OS=Bos taurus GN=PRPS1 PE=2 SV=3 382 496 4.0E-21
sp|Q9CS42|PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus GN=Prps2 PE=1 SV=4 382 496 1.0E-20
sp|Q5XGI0|PRPS2_XENTR Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 382 496 3.0E-20
sp|P09330|PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus GN=Prps2 PE=1 SV=3 382 496 3.0E-20
sp|Q5R8F8|PRPS2_PONAB Ribose-phosphate pyrophosphokinase 2 OS=Pongo abelii GN=PRPS2 PE=2 SV=1 382 496 6.0E-20
sp|Q4R4R7|PRPS2_MACFA Ribose-phosphate pyrophosphokinase 2 OS=Macaca fascicularis GN=PRPS2 PE=2 SV=3 382 496 6.0E-20
sp|P11908|PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens GN=PRPS2 PE=1 SV=2 382 496 6.0E-20
sp|Q7ZXC9|PRPS2_XENLA Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 382 496 1.0E-19
sp|Q54PA9|PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum GN=prsA PE=1 SV=1 360 496 1.0E-19
sp|P21108|PRPS3_HUMAN Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 382 496 2.0E-19
sp|Q5ZI49|PRPS2_CHICK Ribose-phosphate pyrophosphokinase 2 OS=Gallus gallus GN=PRPS2 PE=2 SV=1 382 496 8.0E-19
sp|P38689|KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS3 PE=1 SV=1 309 493 2.0E-17
sp|O94413|KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.06c PE=1 SV=1 357 493 3.0E-17
sp|A5UNK4|KPRS_METS3 Ribose-phosphate pyrophosphokinase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=prs PE=3 SV=1 5 209 4.0E-17
sp|Q12265|KPR5_YEAST Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 384 495 1.0E-16
sp|O26877|KPRS_METTH Ribose-phosphate pyrophosphokinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=prs PE=3 SV=1 31 185 1.0E-16
sp|P44328|KPRS_HAEIN Ribose-phosphate pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prs PE=3 SV=1 380 493 3.0E-16
sp|Q87RN8|KPRS_VIBPA Ribose-phosphate pyrophosphokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prs PE=3 SV=1 380 493 4.0E-16
sp|P38063|KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS4 PE=1 SV=3 357 495 5.0E-16
sp|Q9KQ22|KPRS_VIBCH Ribose-phosphate pyrophosphokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prs PE=3 SV=1 380 493 1.0E-15
sp|Q7MMZ1|KPRS_VIBVY Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain YJ016) GN=prs PE=3 SV=1 380 493 1.0E-15
sp|Q8DFF5|KPRS_VIBVU Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain CMCP6) GN=prs PE=3 SV=2 380 493 1.0E-15
sp|Q7VL55|KPRS_HAEDU Ribose-phosphate pyrophosphokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prs PE=3 SV=1 374 493 1.0E-15
sp|P87171|KPR5_SCHPO Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 382 495 2.0E-15
sp|Q9CP22|KPRS_PASMU Ribose-phosphate pyrophosphokinase OS=Pasteurella multocida (strain Pm70) GN=prs PE=3 SV=1 380 493 2.0E-15
sp|O67556|KPRS_AQUAE Ribose-phosphate pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=prs PE=3 SV=1 376 493 2.0E-15
sp|Q7M8J0|KPRS_WOLSU Ribose-phosphate pyrophosphokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prs PE=3 SV=1 314 494 3.0E-15
sp|Q8K9X2|KPRS_BUCAP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prs PE=3 SV=1 376 495 3.0E-15
sp|Q973F3|KPRS_SULTO Ribose-phosphate pyrophosphokinase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=prs PE=3 SV=1 35 198 1.0E-14
sp|P57266|KPRS_BUCAI Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prs PE=3 SV=1 380 495 2.0E-14
sp|Q8TRK8|KPRS_METAC Ribose-phosphate pyrophosphokinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prs PE=3 SV=1 6 155 2.0E-14
sp|Q8PUX3|KPRS_METMA Ribose-phosphate pyrophosphokinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=prs PE=3 SV=1 6 155 2.0E-14
sp|P46585|KPR1_CANAX Ribose-phosphate pyrophosphokinase 1 OS=Candida albicans GN=PRS1 PE=3 SV=1 309 493 3.0E-14
sp|Q97E93|KPRS_CLOAB Ribose-phosphate pyrophosphokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prs PE=3 SV=1 376 493 3.0E-14
sp|Q7N590|KPRS_PHOLL Ribose-phosphate pyrophosphokinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prs PE=3 SV=1 380 495 4.0E-14
sp|Q7VR76|KPRS_BLOFL Ribose-phosphate pyrophosphokinase OS=Blochmannia floridanus GN=prs PE=3 SV=1 380 496 4.0E-14
sp|Q7U7L5|KPRS_SYNPX Ribose-phosphate pyrophosphokinase OS=Synechococcus sp. (strain WH8102) GN=prs PE=3 SV=1 382 493 5.0E-14
sp|P38620|KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS2 PE=1 SV=1 357 495 6.0E-14
sp|Q8EAQ9|KPRS_SHEON Ribose-phosphate pyrophosphokinase OS=Shewanella oneidensis (strain MR-1) GN=prs PE=3 SV=1 367 495 7.0E-14
sp|P59512|KPRS_BUCBP Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=prs PE=3 SV=1 380 495 7.0E-14
sp|P0A717|KPRS_ECOLI Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) GN=prs PE=1 SV=2 380 495 8.0E-14
sp|P0A718|KPRS_ECOL6 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prs PE=3 SV=2 380 495 8.0E-14
sp|P0A719|KPRS_ECO57 Ribose-phosphate pyrophosphokinase OS=Escherichia coli O157:H7 GN=prs PE=3 SV=2 380 495 8.0E-14
sp|Q7VBH4|KPRS_PROMA Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=prs PE=3 SV=1 382 493 1.0E-13
sp|Q9ZLA1|KPRS_HELPJ Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prs PE=3 SV=1 314 493 2.0E-13
sp|P0A1V6|KPRS_SALTY Ribose-phosphate pyrophosphokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prs PE=3 SV=2 380 495 2.0E-13
sp|P0A1V7|KPRS_SALTI Ribose-phosphate pyrophosphokinase OS=Salmonella typhi GN=prs PE=3 SV=2 380 495 2.0E-13
sp|P65235|KPRS_NEIMB Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=prs PE=1 SV=1 374 493 2.0E-13
sp|P65234|KPRS_NEIMA Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prs PE=3 SV=1 374 493 2.0E-13
sp|Q97Z86|KPRS_SULSO Ribose-phosphate pyrophosphokinase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=prs PE=1 SV=2 5 198 2.0E-13
sp|Q8R753|KPRS_CALS4 Ribose-phosphate pyrophosphokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prs PE=3 SV=1 380 493 3.0E-13
sp|Q8ZEY2|KPRS_YERPE Ribose-phosphate pyrophosphokinase OS=Yersinia pestis GN=prs PE=3 SV=1 380 495 3.0E-13
sp|Q87A22|KPRS_XYLFT Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prs PE=3 SV=1 381 494 3.0E-13
sp|Q9PA76|KPRS_XYLFA Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain 9a5c) GN=prs PE=3 SV=2 381 494 4.0E-13
sp|P56184|KPRS_HELPY Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prs PE=3 SV=1 314 493 5.0E-13
sp|Q59988|KPRS_SYNE7 Ribose-phosphate pyrophosphokinase OS=Synechococcus elongatus (strain PCC 7942) GN=prs PE=3 SV=1 380 493 5.0E-13
sp|Q4J9A6|KPRS_SULAC Ribose-phosphate pyrophosphokinase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=prs PE=3 SV=1 5 196 8.0E-13
sp|Q7NM67|KPRS_GLOVI Ribose-phosphate pyrophosphokinase OS=Gloeobacter violaceus (strain PCC 7421) GN=prs PE=3 SV=1 370 493 9.0E-13
sp|Q8EZN0|KPRS_LEPIN Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prs PE=3 SV=1 374 493 1.0E-12
sp|Q72V73|KPRS_LEPIC Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prs PE=3 SV=1 374 493 1.0E-12
sp|Q83AQ1|KPRS_COXBU Ribose-phosphate pyrophosphokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prs PE=3 SV=1 376 494 1.0E-12
sp|O59586|KPRS_PYRHO Ribose-phosphate pyrophosphokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prs PE=3 SV=1 3 196 1.0E-12
sp|O60256|KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens GN=PRPSAP2 PE=1 SV=1 382 497 2.0E-12
sp|Q9PP15|KPRS_CAMJE Ribose-phosphate pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prs PE=3 SV=1 380 494 2.0E-12
sp|Q8KCQ2|KPRS_CHLTE Ribose-phosphate pyrophosphokinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prs PE=3 SV=1 374 493 2.0E-12
sp|Q98R83|KPRS_MYCPU Ribose-phosphate pyrophosphokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prs PE=3 SV=1 380 493 2.0E-12
sp|Q88PX6|KPRS_PSEPK Ribose-phosphate pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=prs PE=3 SV=1 374 493 3.0E-12
sp|Q888C6|KPRS_PSESM Ribose-phosphate pyrophosphokinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prs PE=3 SV=1 374 493 3.0E-12
sp|O08618|KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=1 SV=1 382 497 4.0E-12
sp|Q5RBA8|KPRB_PONAB Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 382 497 4.0E-12
sp|Q8R574|KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 382 497 4.0E-12
sp|Q5ZL26|KPRB_CHICK Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 382 497 4.0E-12
sp|Q8EU34|KPRS_OCEIH Ribose-phosphate pyrophosphokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prs PE=3 SV=1 376 493 4.0E-12
sp|Q6AJL7|KPRS_DESPS Ribose-phosphate pyrophosphokinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prs PE=3 SV=1 376 494 4.0E-12
sp|Q7V111|KPRS_PROMP Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=prs PE=3 SV=1 382 493 4.0E-12
sp|Q8YN97|KPRS_NOSS1 Ribose-phosphate pyrophosphokinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prs PE=3 SV=1 380 493 4.0E-12
sp|Q9RUD2|KPRS_DEIRA Ribose-phosphate pyrophosphokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=prs PE=3 SV=2 384 493 5.0E-12
sp|Q9HLV6|KPRS_THEAC Ribose-phosphate pyrophosphokinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=prs PE=3 SV=2 6 218 5.0E-12
sp|Q7NQS9|KPRS_CHRVO Ribose-phosphate pyrophosphokinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prs PE=3 SV=1 374 493 6.0E-12
sp|P42816|KPRS_BACCL Ribose-phosphate pyrophosphokinase OS=Bacillus caldolyticus GN=prs PE=3 SV=1 376 493 6.0E-12
sp|Q7UPM4|KPRS_RHOBA Ribose-phosphate pyrophosphokinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=prs PE=3 SV=1 359 493 7.0E-12
sp|Q7VFY9|KPRS_HELHP Ribose-phosphate pyrophosphokinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prs PE=3 SV=1 314 494 7.0E-12
sp|Q58761|KPRS_METJA Ribose-phosphate pyrophosphokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=prs PE=1 SV=2 5 156 7.0E-12
sp|A6W1C7|KPRS_MARMS Ribose-phosphate pyrophosphokinase OS=Marinomonas sp. (strain MWYL1) GN=prs PE=3 SV=1 380 493 9.0E-12
sp|A2VDS0|KPRB_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 382 497 2.0E-11
sp|Q28DH0|KPRB_XENTR Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 375 497 2.0E-11
sp|Q63468|KPRA_RAT Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 382 493 2.0E-11
sp|P14193|KPRS_BACSU Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=prs PE=1 SV=1 376 493 2.0E-11
sp|Q7V6S2|KPRS_PROMM Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain MIT 9313) GN=prs PE=3 SV=1 382 493 2.0E-11
sp|Q97CA5|KPRS_THEVO Ribose-phosphate pyrophosphokinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=prs PE=1 SV=1 6 217 2.0E-11
sp|Q8ZU24|KPRS_PYRAE Ribose-phosphate pyrophosphokinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=prs PE=3 SV=1 28 219 2.0E-11
sp|Q9HVC5|KPRS_PSEAE Ribose-phosphate pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prs PE=3 SV=1 374 493 3.0E-11
sp|Q8TUT6|KPRS_METKA Ribose-phosphate pyrophosphokinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=prs PE=3 SV=1 5 216 5.0E-11
sp|Q82TQ4|KPRS_NITEU Ribose-phosphate pyrophosphokinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prs PE=3 SV=1 376 495 6.0E-11
sp|Q1LTH2|KPRS_BAUCH Ribose-phosphate pyrophosphokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prs PE=3 SV=1 380 495 6.0E-11
sp|Q8PNU0|KPRS_XANAC Ribose-phosphate pyrophosphokinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prs PE=3 SV=2 381 494 6.0E-11
sp|Q42581|KPRS1_ARATH Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Arabidopsis thaliana GN=PRS1 PE=2 SV=2 380 494 6.0E-11
sp|Q9D0M1|KPRA_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 382 493 7.0E-11
sp|Q14558|KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 382 493 8.0E-11
sp|O33924|KPRS_CORAM Ribose-phosphate pyrophosphokinase OS=Corynebacterium ammoniagenes GN=prs PE=3 SV=1 376 493 9.0E-11
sp|Q7VUH1|KPRS_BORPE Ribose-phosphate pyrophosphokinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prs PE=3 SV=2 380 493 9.0E-11
sp|Q08DW2|KPRA_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 382 493 1.0E-10
sp|Q899I8|KPRS_CLOTE Ribose-phosphate pyrophosphokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=prs PE=3 SV=1 376 493 1.0E-10
sp|Q81J97|KPRS_BACCR Ribose-phosphate pyrophosphokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prs PE=3 SV=1 376 493 1.0E-10
sp|Q81VZ0|KPRS_BACAN Ribose-phosphate pyrophosphokinase OS=Bacillus anthracis GN=prs PE=3 SV=1 376 493 1.0E-10
sp|Q9CEI4|KPRS2_LACLA Ribose-phosphate pyrophosphokinase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs2 PE=3 SV=1 363 495 1.0E-10
sp|Q82ZA5|KPRS2_ENTFA Ribose-phosphate pyrophosphokinase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs2 PE=3 SV=1 374 493 2.0E-10
sp|P75044|KPRS_MYCPN Ribose-phosphate pyrophosphokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prs PE=3 SV=3 382 493 2.0E-10
sp|Q7W181|KPRS_BORPA Ribose-phosphate pyrophosphokinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prs PE=3 SV=1 380 493 3.0E-10
sp|Q7WNY4|KPRS_BORBR Ribose-phosphate pyrophosphokinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prs PE=3 SV=1 380 493 3.0E-10
sp|Q55848|KPRS_SYNY3 Ribose-phosphate pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prs PE=3 SV=1 381 493 4.0E-10
sp|P47304|KPRS_MYCGE Ribose-phosphate pyrophosphokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prs PE=3 SV=2 382 493 4.0E-10
sp|Q9XG99|KPRS2_SPIOL Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Spinacia oleracea GN=PRS2 PE=2 SV=1 380 493 4.0E-10
sp|Q89DJ1|KPRS_BRADU Ribose-phosphate pyrophosphokinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prs PE=3 SV=2 376 493 6.0E-10
sp|Q9EWS0|KPRH_STRCO Putative ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0782 PE=3 SV=1 383 493 6.0E-10
sp|Q42583|KPRS2_ARATH Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Arabidopsis thaliana GN=PRS2 PE=2 SV=2 380 494 7.0E-10
sp|Q8RHM2|KPRS_FUSNN Ribose-phosphate pyrophosphokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prs PE=3 SV=1 376 493 1.0E-09
sp|Q9CHB8|KPRS1_LACLA Ribose-phosphate pyrophosphokinase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs1 PE=3 SV=1 381 495 1.0E-09
sp|Q6Z2L5|KPRS1_ORYSJ Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0127700 PE=2 SV=2 380 484 1.0E-09
sp|O52958|KPRS_THEKO Ribose-phosphate pyrophosphokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prs PE=1 SV=1 20 189 1.0E-09
sp|Q8Y2E1|KPRS_RALSO Ribose-phosphate pyrophosphokinase OS=Ralstonia solanacearum (strain GMI1000) GN=prs PE=3 SV=1 374 493 2.0E-09
sp|Q8PC63|KPRS_XANCP Ribose-phosphate pyrophosphokinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prs PE=3 SV=1 381 494 2.0E-09
sp|Q8G5P2|KPRS_BIFLO Ribose-phosphate pyrophosphokinase OS=Bifidobacterium longum (strain NCC 2705) GN=prs PE=3 SV=2 354 493 2.0E-09
sp|Q8U458|KPRS_PYRFU Ribose-phosphate pyrophosphokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prs PE=3 SV=1 5 214 2.0E-09
sp|Q9UY08|KPRS_PYRAB Ribose-phosphate pyrophosphokinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=prs PE=3 SV=2 29 196 2.0E-09
sp|Q0C5A1|KPRS_HYPNA Ribose-phosphate pyrophosphokinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=prs PE=3 SV=1 377 493 4.0E-09
sp|Q8DZK4|KPRS2_STRA5 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs2 PE=3 SV=1 384 498 5.0E-09
sp|Q8E568|KPRS2_STRA3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs2 PE=3 SV=1 384 498 5.0E-09
sp|O28853|KPRS2_ARCFU Ribose-phosphate pyrophosphokinase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prs2 PE=3 SV=1 11 216 8.0E-09
sp|P9WKE3|KPRS_MYCTU Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prs PE=1 SV=1 384 493 9.0E-09
sp|P9WKE2|KPRS_MYCTO Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prs PE=3 SV=1 384 493 9.0E-09
sp|P65233|KPRS_MYCBO Ribose-phosphate pyrophosphokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prs PE=3 SV=1 384 493 9.0E-09
sp|Q9AAV6|KPRS_CAUCR Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prs PE=3 SV=1 376 493 9.0E-09
sp|B8GZV1|KPRS_CAUCN Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prs PE=3 SV=1 376 493 9.0E-09
sp|Q69XQ6|KPRS2_ORYSJ Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0617800 PE=2 SV=2 380 493 1.0E-08
sp|Q9X1W3|KPRS_THEMA Ribose-phosphate pyrophosphokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prs PE=3 SV=1 380 493 2.0E-08
sp|Q8FZF0|KPRS_BRUSU Ribose-phosphate pyrophosphokinase OS=Brucella suis biovar 1 (strain 1330) GN=prs PE=3 SV=1 376 493 2.0E-08
sp|Q8NRU9|KPRS_CORGL Ribose-phosphate pyrophosphokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prs PE=3 SV=1 384 493 3.0E-08
sp|Q8DU94|KPRS2_STRMU Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs2 PE=3 SV=1 362 495 3.0E-08
sp|Q8YIG1|KPRS_BRUME Ribose-phosphate pyrophosphokinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prs PE=3 SV=2 376 493 4.0E-08
sp|Q88VA5|KPRS2_LACPL Ribose-phosphate pyrophosphokinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs2 PE=3 SV=1 374 493 4.0E-08
sp|O59586|KPRS_PYRHO Ribose-phosphate pyrophosphokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prs PE=3 SV=1 387 455 4.0E-08
sp|Q9XG98|KPRS1_SPIOL Ribose-phosphate pyrophosphokinase 1 OS=Spinacia oleracea GN=PRS1 PE=2 SV=1 380 493 5.0E-08
sp|Q8XHJ4|KPRS_CLOPE Ribose-phosphate pyrophosphokinase OS=Clostridium perfringens (strain 13 / Type A) GN=prs PE=3 SV=1 374 493 6.0E-08
sp|Q88Z84|KPRS1_LACPL Ribose-phosphate pyrophosphokinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs1 PE=3 SV=1 380 493 6.0E-08
sp|Q5XC85|KPRS2_STRP6 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs2 PE=1 SV=1 384 495 1.0E-07
sp|P0DC01|KPRS2_STRPQ Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs2 PE=3 SV=1 384 495 1.0E-07
sp|P0DC00|KPRS2_STRP3 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs2 PE=3 SV=1 384 495 1.0E-07
sp|O52958|KPRS_THEKO Ribose-phosphate pyrophosphokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prs PE=1 SV=1 387 471 1.0E-07
sp|Q75JN8|PRPSB_DICDI Ribose-phosphate pyrophosphokinase B OS=Dictyostelium discoideum GN=prsB PE=3 SV=1 384 492 2.0E-07
sp|Q54QU9|PRPSC_DICDI Ribose-phosphate pyrophosphokinase C OS=Dictyostelium discoideum GN=prsC PE=3 SV=1 379 490 2.0E-07
sp|Q92EF1|KPRS2_LISIN Ribose-phosphate pyrophosphokinase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs2 PE=3 SV=1 376 493 2.0E-07
sp|B7IFM5|KPRS_THEAB Ribose-phosphate pyrophosphokinase OS=Thermosipho africanus (strain TCF52B) GN=prs PE=3 SV=1 380 493 3.0E-07
sp|Q92N73|KPRS_RHIME Ribose-phosphate pyrophosphokinase OS=Rhizobium meliloti (strain 1021) GN=prs PE=3 SV=1 376 493 3.0E-07
sp|Q9CD45|KPRS_MYCLE Ribose-phosphate pyrophosphokinase OS=Mycobacterium leprae (strain TN) GN=prs PE=3 SV=1 384 493 3.0E-07
sp|Q8P137|KPRS2_STRP8 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs2 PE=3 SV=1 384 493 3.0E-07
sp|Q8Y9L8|KPRS2_LISMO Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs2 PE=3 SV=1 376 493 3.0E-07
sp|Q723E1|KPRS2_LISMF Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs2 PE=3 SV=1 376 493 3.0E-07
sp|Q8U458|KPRS_PYRFU Ribose-phosphate pyrophosphokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prs PE=3 SV=1 387 455 3.0E-07
sp|Q99ZR0|KPRS2_STRP1 Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M1 GN=prs2 PE=3 SV=1 384 495 4.0E-07
sp|Q0ARN5|KPRS_MARMM Ribose-phosphate pyrophosphokinase OS=Maricaulis maris (strain MCS10) GN=prs PE=3 SV=1 377 493 4.0E-07
sp|Q9K3U0|KPRS_STRCO Ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prs PE=3 SV=1 384 493 4.0E-07
sp|Q8CQU7|KPRS_STAES Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prs PE=3 SV=1 376 493 5.0E-07
sp|Q5HRQ5|KPRS_STAEQ Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prs PE=3 SV=1 376 493 5.0E-07
sp|Q832Z5|KPRS1_ENTFA Ribose-phosphate pyrophosphokinase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs1 PE=3 SV=1 363 493 5.0E-07
sp|O29666|KPRS1_ARCFU Ribose-phosphate pyrophosphokinase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prs1 PE=3 SV=2 5 133 5.0E-07
sp|Q5HIH5|KPRS_STAAC Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain COL) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|P65238|KPRS_STAAW Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|Q6GBY8|KPRS_STAAS Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|Q6GJH1|KPRS_STAAR Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|P65237|KPRS_STAAN Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=prs PE=1 SV=1 376 493 6.0E-07
sp|P65236|KPRS_STAAM Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prs PE=3 SV=1 376 493 6.0E-07
sp|B9KPJ0|KPRS_RHOSK Ribose-phosphate pyrophosphokinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prs PE=3 SV=1 376 493 9.0E-07
sp|Q8FQV2|KPRS_COREF Ribose-phosphate pyrophosphokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prs PE=3 SV=1 384 493 1.0E-06
sp|O64888|KPRS5_ARATH Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PRS5 PE=2 SV=2 380 484 1.0E-06
sp|Q49V09|KPRS_STAS1 Ribose-phosphate pyrophosphokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=prs PE=3 SV=1 376 493 2.0E-06
sp|Q82HE7|KPRS_STRAW Ribose-phosphate pyrophosphokinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prs PE=3 SV=1 384 493 2.0E-06
sp|Q8DWM2|KPRS1_STRMU Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs1 PE=3 SV=1 367 496 3.0E-06
sp|Q9HN88|KPRS_HALSA Ribose-phosphate pyrophosphokinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=prs PE=3 SV=1 29 195 3.0E-06
sp|B0R7B4|KPRS_HALS3 Ribose-phosphate pyrophosphokinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=prs PE=3 SV=1 29 195 3.0E-06
sp|Q9KGJ5|KPRS_BACHD Ribose-phosphate pyrophosphokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prs PE=3 SV=1 376 493 4.0E-06
sp|Q7MT83|KPRS_PORGI Ribose-phosphate pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prs PE=3 SV=1 384 493 4.0E-06
sp|Q98HW3|KPRS_RHILO Ribose-phosphate pyrophosphokinase OS=Rhizobium loti (strain MAFF303099) GN=prs PE=3 SV=1 376 493 4.0E-06
sp|Q4L3F7|KPRS_STAHJ Ribose-phosphate pyrophosphokinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prs PE=3 SV=1 376 493 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009165 nucleotide biosynthetic process Yes
GO:0004749 ribose phosphate diphosphokinase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0006807 nitrogen compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016778 diphosphotransferase activity No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0090407 organophosphate biosynthetic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5611
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4466
Ophiocordyceps australis map64 (Brazil) OphauB2|1123 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05579
Ophiocordyceps camponoti-rufipedis Ophun1|7598
Ophiocordyceps kimflemingae Ophio5|2803
Ophiocordyceps subramaniannii Hirsu2|7595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1123
MRNTLIFAGNSCPVLTGQICQNLGTFPADAELTQFSNGETSVRILTSVREKDVFVVQSGSPRINDSIMELLIMIS
ACKGGSANKVTAVLPYFPYSRQSKKKSHRGAITARMLANLLGVAGVRHVITVDLHASQMQGFFKCPVDNLHAEPI
IAKWIRRNVPNWREAVVVSKNAGGTKRVTSLADALKLNFGMVTTDRKRGPSTTTSLIMNHLDVSERRTAPEYGAR
VSNEFDVESRPDKTPLRKPRILSNSRGSPTPRGRSSPPVSLEHGTSTVSHSKTPVRSIPSQPSDAEPQSPIDQVF
DDRRAQEVIHGRLVQGHIVADDFSPARSATEPSVAGDDPMTMSHASSFFAPEPQSLGGGGDAAVSSDEEDNAFRY
PGAEHMITLVGNVRNRTVFIVDDMIDKPGSWIAAAETVVKKGHAKKVYCIATHGVFGGDCLEQLQACECIDTIVV
TNSFPINHDRARNTSKLVILDLSFLLAEAIRRNHYGESISPLFLHTGD*
Coding >OphauB2|1123
ATGCGTAATACTCTTATATTCGCCGGCAATTCTTGCCCTGTTCTCACGGGCCAGATCTGCCAGAATCTGGGCACG
TTCCCCGCAGACGCGGAACTCACCCAATTCTCCAACGGCGAAACGAGTGTCAGGATTCTCACCAGCGTTCGAGAA
AAAGACGTCTTCGTCGTTCAGTCGGGCAGCCCCCGCATCAATGACTCCATCATGGAGCTTCTCATCATGATCTCG
GCTTGTAAAGGAGGCTCGGCCAACAAGGTCACAGCCGTCTTGCCTTATTTCCCATATAGTCGTCAGTCCAAGAAG
AAGTCGCACAGAGGCGCCATCACAGCTCGCATGCTGGCAAATCTTCTCGGTGTGGCCGGCGTTAGACACGTCATC
ACCGTTGATCTCCATGCATCGCAGATGCAGGGCTTCTTCAAATGTCCCGTAGACAATCTACATGCCGAGCCCATC
ATCGCAAAATGGATACGGCGCAACGTCCCCAACTGGCGCGAGGCCGTTGTTGTTTCAAAGAATGCTGGGGGCACC
AAGCGTGTCACCTCGCTCGCTGATGCACTCAAGCTCAACTTTGGCATGGTGACGACGGATCGCAAGCGAGGACCA
AGTACAACAACTAGCTTGATTATGAATCACCTAGATGTCTCTGAACGCCGAACAGCTCCGGAGTATGGAGCTCGC
GTGTCGAATGAATTCGACGTGGAATCACGGCCTGACAAGACTCCACTTCGAAAACCCAGGATATTATCAAATTCG
AGAGGCTCACCAACGCCACGCGGTAGAAGTTCACCGCCAGTATCCCTGGAACATGGCACATCGACTGTCTCACAT
TCCAAGACCCCTGTTCGATCAATACCTAGCCAGCCGTCAGACGCAGAGCCTCAGTCTCCCATAGACCAGGTATTT
GACGATCGGCGTGCCCAAGAGGTTATCCATGGCCGTCTAGTCCAAGGCCACATTGTTGCAGACGACTTTTCGCCC
GCAAGGTCAGCGACCGAACCTAGTGTTGCAGGAGACGACCCCATGACCATGTCACATGCTTCATCATTCTTCGCG
CCAGAACCGCAGTCTCTGGGGGGCGGTGGTGATGCAGCAGTCAGCTCAGACGAAGAGGATAATGCGTTTCGTTAT
CCAGGAGCCGAGCATATGATTACCCTTGTCGGAAATGTGCGGAATAGGACTGTCTTCATCGTGGATGACATGATA
GACAAACCGGGTTCGTGGATCGCCGCAGCCGAGACAGTAGTCAAAAAGGGCCATGCTAAAAAGGTATACTGCATT
GCTACCCACGGAGTCTTTGGTGGGGACTGTCTAGAGCAATTACAAGCATGTGAGTGCATCGACACCATAGTGGTC
ACCAACAGCTTCCCCATCAATCACGACCGTGCCCGAAACACGAGCAAGTTGGTCATTCTAGACTTGTCTTTTCTT
TTGGCTGAAGCAATTCGTCGCAACCATTATGGCGAGTCTATATCTCCATTGTTTCTACACACTGGAGATTAG
Transcript >OphauB2|1123
ATGCGTAATACTCTTATATTCGCCGGCAATTCTTGCCCTGTTCTCACGGGCCAGATCTGCCAGAATCTGGGCACG
TTCCCCGCAGACGCGGAACTCACCCAATTCTCCAACGGCGAAACGAGTGTCAGGATTCTCACCAGCGTTCGAGAA
AAAGACGTCTTCGTCGTTCAGTCGGGCAGCCCCCGCATCAATGACTCCATCATGGAGCTTCTCATCATGATCTCG
GCTTGTAAAGGAGGCTCGGCCAACAAGGTCACAGCCGTCTTGCCTTATTTCCCATATAGTCGTCAGTCCAAGAAG
AAGTCGCACAGAGGCGCCATCACAGCTCGCATGCTGGCAAATCTTCTCGGTGTGGCCGGCGTTAGACACGTCATC
ACCGTTGATCTCCATGCATCGCAGATGCAGGGCTTCTTCAAATGTCCCGTAGACAATCTACATGCCGAGCCCATC
ATCGCAAAATGGATACGGCGCAACGTCCCCAACTGGCGCGAGGCCGTTGTTGTTTCAAAGAATGCTGGGGGCACC
AAGCGTGTCACCTCGCTCGCTGATGCACTCAAGCTCAACTTTGGCATGGTGACGACGGATCGCAAGCGAGGACCA
AGTACAACAACTAGCTTGATTATGAATCACCTAGATGTCTCTGAACGCCGAACAGCTCCGGAGTATGGAGCTCGC
GTGTCGAATGAATTCGACGTGGAATCACGGCCTGACAAGACTCCACTTCGAAAACCCAGGATATTATCAAATTCG
AGAGGCTCACCAACGCCACGCGGTAGAAGTTCACCGCCAGTATCCCTGGAACATGGCACATCGACTGTCTCACAT
TCCAAGACCCCTGTTCGATCAATACCTAGCCAGCCGTCAGACGCAGAGCCTCAGTCTCCCATAGACCAGGTATTT
GACGATCGGCGTGCCCAAGAGGTTATCCATGGCCGTCTAGTCCAAGGCCACATTGTTGCAGACGACTTTTCGCCC
GCAAGGTCAGCGACCGAACCTAGTGTTGCAGGAGACGACCCCATGACCATGTCACATGCTTCATCATTCTTCGCG
CCAGAACCGCAGTCTCTGGGGGGCGGTGGTGATGCAGCAGTCAGCTCAGACGAAGAGGATAATGCGTTTCGTTAT
CCAGGAGCCGAGCATATGATTACCCTTGTCGGAAATGTGCGGAATAGGACTGTCTTCATCGTGGATGACATGATA
GACAAACCGGGTTCGTGGATCGCCGCAGCCGAGACAGTAGTCAAAAAGGGCCATGCTAAAAAGGTATACTGCATT
GCTACCCACGGAGTCTTTGGTGGGGACTGTCTAGAGCAATTACAAGCATGTGAGTGCATCGACACCATAGTGGTC
ACCAACAGCTTCCCCATCAATCACGACCGTGCCCGAAACACGAGCAAGTTGGTCATTCTAGACTTGTCTTTTCTT
TTGGCTGAAGCAATTCGTCGCAACCATTATGGCGAGTCTATATCTCCATTGTTTCTACACACTGGAGATTAG
Gene >OphauB2|1123
ATGCGTAATACTCTTATATTCGCCGGCAATTCTTGCCCTGTTCTCACGGGCCAGATCTGCCAGAATCTGGGCACG
TTCCCCGCAGACGCGGAACTCACCCAATTCTCCAACGTGAGTGAGCGCCCCTACGTCTTGCAACACAAGGAGGCA
GAACTGCCTACCTGGCAGGTAGTAGCTGCCAAGCTGCGCCTTGTAATGCTATGAGGCAGGCCTGGCCGTTTCGCC
CTTTTGCTTGCATGGTGCCAATCTAATAGCAAGTCGTGCTGCTCAAGGGCGAAACGAGTGTCAGGATTCTCACCA
GCGTTCGAGAAAAAGACGTCTTCGTCGTTCAGTCGGGCAGCCCCCGCATCAATGACTCCATCATGGAGCTTCTCA
TCATGATCTCGGCTTGTAAAGGAGGCTCGGCCAACAAGGTCACAGGTCAGTCTTGCCCAGCTCCTTGGTCATGAG
GCCAAGGTGATTAATTATTTCCCTGCTGCAGCCGTCTTGCCTTATTTCCCATATAGTCGTCAGTCCAAGAAGAAG
TCGCACAGAGGCGCCATCACAGCTCGCATGCTGGCAAATCTTCTCGGTGTGGCCGGCGTTAGACACGTCATCACC
GTTGATCTCCATGCATCGCAGATGCAGGGCTTCTTCAAATGTCCCGTAGACAATCTACATGCCGAGCCCATCATC
GCAAAATGGATACGGCGCAACGTCCCCAACTGGCGCGAGGCCGTTGTTGTTTCAAAGAATGCTGGGGGCACCAAG
CGTGTCACCTCGCTCGCTGATGCACTCAAGCTCAACTTTGGCATGGTGACGACGGATCGCAAGCGAGGACCAAGT
ACAACAACTAGCTTGATTATGAATCACCTAGATGTCTCTGAACGCCGAACAGCTCCGGAGTATGGAGCTCGCGTG
TCGAATGAATTCGACGTGGAATCACGGCCTGACAAGACTCCACTTCGAAAACCCAGGATATTATCAAATTCGAGA
GGCTCACCAACGCCACGCGGTAGAAGTTCACCGCCAGTATCCCTGGAACATGGCACATCGACTGTCTCACATTCC
AAGACCCCTGTTCGATCAATACCTAGCCAGCCGTCAGACGCAGAGCCTCAGTCTCCCATAGACCAGGTATTTGAC
GATCGGCGTGCCCAAGAGGTTATCCATGGCCGTCTAGTCCAAGGCCACATTGTTGCAGACGACTTTTCGCCCGCA
AGGTCAGCGACCGAACCTAGTGTTGCAGGAGACGACCCCATGACCATGTCACATGCTTCATCATTCTTCGCGCCA
GAACCGCAGTCTCTGGGGGGCGGTGGTGATGCAGCAGTCAGCTCAGACGAAGAGGATAATGCGTTTCGTTATCCA
GGAGCCGAGCATATGATTACCCTTGTCGGAAATGTGCGGAATAGGACTGTCTTCATCGTGGATGACATGATAGAC
AAACCGGGTTCGTGGATCGCCGCAGCCGAGACAGTAGTCAAAAAGGGCCATGCTAAAAAGGTATACTGCATTGCT
ACCCACGGAGTCTTTGGTGGGGACTGTCTAGAGCAATTACAAGCATGTGAGTGCATCGACACCATAGTGGTCACC
AACAGCTTCCCCATCAATCACGACCGTGCCCGAAACACGAGCAAGTTGGTCATTCTAGACTTGTCTTTTCTTTTG
GCTGAAGCAATTCGTCGCAACCATTATGGCGAGTCTATATCTCCATTGTTTCTACACACTGGAGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail