Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1112
Gene name
LocationContig_127:3566..6350
Strand-
Gene length (bp)2784
Transcript length (bp)2784
Coding sequence length (bp)2784
Protein length (aa) 928

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 4.6E-08 873 919

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P54074|ASI1_YEAST Protein ASI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASI1 PE=1 SV=1 839 924 3.0E-12
sp|P53983|ASI3_YEAST Protein ASI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASI3 PE=1 SV=2 865 924 7.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 320 342 22
2 349 371 22
3 391 413 22
4 576 598 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1112
MDREPDSILSNPHGAPASGLYHVVAWAANATSFFITKLIAQPPLEAASTDSLSMGASEPTALAAAASASSSASAS
LSSGQETMMPASRLSLDGSRGLSSVFNYAVSKWALSCVAMAIILNRTHIFAATRRRLHLRWPVRLAVRLVPVVLL
TLQVRRLLQSIQCQTSSTFVRMYSANATFSRPNPLLNALSSALLLGATDEHSCTAFYTTFFSNTPAHSTRFHGSL
SLLWPLFGTFCLSHLLETLMAAVQGLPMVSQTGMTLFEQSLAFAEADAAVMNQLGRAALSKASSVLSAHSSSGLG
PEMALSGSAILTQANAAPEVLLVALLSSMAHISSHVLGIFDLQAKHRLFNTGFWAICFMASIIVTALSFDPDDTS
SQGLLRFPTVCIISFIPHVLVLAGVATCLCIYFFGLLLSALAPPVHRQLPPLTFRQRFAYAQRNMQANLSISDIR
ITADMDFYTALLRMGFAAMTMASEAVYLNEDRGVSLKKRTWLEEARLRDLEELQRRCIGLGLPGSRYDQIGTVGL
IPIKDASVLACNGYNRERAAQVLPKGRSERGVRVGTGATERSSRWIMALEFLLSIWQLMVRVAALSGLWALGLVR
IRARPAWLLWLARRSKSANVAGRRQRCSQDVSLSDNQQTSELHRDERSDYDDEEHKFKGNGLDVEEEFRRVRPMS
DEEALDQDLYVYWLNGGWWGSRDSSGDFNPMSAEDDWDATSVVSVTSDEQSFGTEWESESDGQKTPTQASPLPRS
SRGNSPYVDSPLGINDLARLLRPTNRQDREEALTLATHLQTDKIMTRARFSQLDRLRRARVLATSDTRVNSGLES
LAPYTKLGPDEEERLLEQLLLSHRRQSRPRNSTEPLEGSSSDEAAEGRPCVVCQTSMRTIIVWPCRCLSLCDDCR
VSLAMNNFDKCVCCRRDVMSFSRIFVP*
Coding >OphauB2|1112
ATGGACCGTGAGCCCGACTCAATCCTCTCGAATCCCCATGGCGCGCCAGCTTCGGGCCTGTATCATGTGGTGGCG
TGGGCAGCTAACGCAACGTCATTCTTTATCACGAAGCTTATAGCCCAGCCACCCCTTGAGGCTGCTTCGACGGAT
AGCCTGAGCATGGGCGCCTCTGAGCCGACGGCTCTGGCTGCGGCCGCCTCTGCTTCTTCCTCTGCCTCGGCCTCT
CTCTCGTCCGGACAGGAGACCATGATGCCGGCATCGCGCCTCTCTCTCGACGGCTCCCGAGGCCTCAGTAGCGTC
TTCAATTATGCTGTCAGCAAATGGGCCCTTTCGTGCGTCGCCATGGCCATTATCCTCAACCGCACTCACATCTTT
GCTGCCACGCGCCGCCGCTTGCATCTCCGCTGGCCTGTCAGACTGGCTGTTCGTCTGGTGCCAGTCGTGCTCCTG
ACGCTCCAAGTTCGCCGTCTTCTCCAGTCGATTCAGTGCCAGACTTCTTCAACCTTTGTCCGCATGTACTCGGCC
AACGCCACTTTTTCGCGTCCGAATCCCCTGCTCAACGCCCTCAGCTCAGCCTTGCTTCTGGGCGCCACGGACGAG
CACTCGTGCACTGCCTTTTACACAACCTTCTTCTCCAATACACCCGCTCACTCGACCCGGTTTCATGGATCGCTT
TCACTTCTGTGGCCCTTGTTTGGCACGTTTTGCCTCAGCCACCTACTCGAAACTCTCATGGCAGCCGTCCAGGGC
TTGCCCATGGTATCCCAGACGGGCATGACCCTCTTTGAGCAGTCGCTGGCTTTTGCCGAGGCTGATGCCGCTGTT
ATGAATCAACTGGGCCGCGCCGCTTTGTCCAAGGCCTCGTCGGTCTTGTCAGCCCATAGCTCGTCGGGCCTTGGC
CCTGAAATGGCGTTATCCGGCTCTGCCATACTTACGCAGGCCAATGCAGCCCCAGAGGTGCTTTTGGTGGCTTTA
CTGTCGTCAATGGCCCATATCAGTAGCCATGTTCTTGGAATATTCGACCTCCAGGCAAAACATAGGCTTTTCAAT
ACTGGCTTCTGGGCCATCTGCTTCATGGCAAGCATCATAGTCACGGCTCTTTCTTTTGACCCCGACGACACTTCC
AGTCAGGGACTACTTAGATTTCCAACAGTTTGCATCATCAGCTTTATTCCTCATGTTCTTGTCCTGGCCGGAGTT
GCCACTTGCTTGTGTATCTATTTTTTCGGCCTGCTACTTTCAGCTTTAGCCCCTCCAGTACATCGTCAGCTTCCC
CCCTTGACTTTTCGTCAACGTTTTGCTTATGCACAACGCAACATGCAGGCAAATCTGTCGATATCCGACATAAGA
ATTACGGCTGACATGGACTTTTATACCGCATTACTCAGGATGGGCTTTGCTGCCATGACCATGGCCAGTGAGGCA
GTCTATCTAAACGAGGATCGCGGTGTCAGCCTGAAGAAGCGCACTTGGTTAGAGGAGGCACGTTTACGCGATCTC
GAGGAGCTACAAAGGCGTTGTATTGGCCTCGGACTACCTGGCTCCCGCTACGATCAGATTGGCACTGTTGGTCTC
ATACCGATCAAGGACGCGTCGGTCCTCGCCTGCAACGGGTACAATAGGGAGCGCGCTGCCCAAGTTTTGCCCAAG
GGCCGCAGCGAGCGTGGTGTCCGCGTAGGCACTGGGGCGACTGAGAGGAGCTCGAGATGGATCATGGCATTGGAA
TTTCTCTTGAGCATATGGCAGCTCATGGTCCGGGTTGCCGCTTTATCTGGTCTGTGGGCTCTCGGCCTCGTGCGC
ATTCGGGCTCGTCCAGCCTGGCTGCTCTGGCTCGCCCGCCGTTCCAAGTCGGCGAATGTCGCGGGGCGGCGACAA
AGATGCTCCCAAGATGTTTCTCTGAGCGACAACCAACAGACTTCAGAATTACACCGAGATGAGCGCAGTGATTAC
GATGACGAAGAACACAAATTCAAGGGCAACGGTCTCGACGTGGAAGAAGAGTTTAGGCGGGTTAGACCAATGAGC
GACGAAGAGGCGCTCGATCAAGACTTATATGTATACTGGCTCAATGGCGGTTGGTGGGGTTCCCGCGACTCGAGT
GGCGATTTCAACCCCATGTCAGCAGAAGACGACTGGGATGCCACAAGTGTGGTCAGCGTTACCAGCGACGAGCAG
TCTTTTGGCACGGAGTGGGAGTCGGAAAGCGACGGACAAAAAACGCCCACTCAAGCGTCGCCACTGCCACGAAGC
TCGCGTGGCAACAGTCCATATGTCGATAGTCCGCTCGGGATAAACGATCTTGCGCGATTACTGCGTCCGACAAAT
CGCCAAGACCGCGAAGAGGCACTGACCCTGGCGACGCATCTGCAAACAGACAAGATTATGACGAGGGCGCGTTTT
TCGCAGCTCGACCGACTAAGGCGTGCTCGTGTCCTTGCAACGTCGGACACACGAGTCAACAGTGGCCTTGAGTCT
CTGGCGCCCTACACCAAGCTCGGCCCTGACGAGGAGGAACGCTTGCTGGAACAGCTTTTACTGTCTCATCGCCGC
CAGTCAAGGCCGAGAAACTCGACCGAGCCGCTTGAGGGCTCGTCAAGCGACGAAGCGGCTGAGGGCCGGCCGTGT
GTCGTGTGCCAGACATCGATGCGCACCATTATAGTCTGGCCGTGTCGGTGTCTGAGCTTATGCGATGATTGCCGC
GTGTCACTGGCCATGAACAATTTTGACAAGTGTGTGTGTTGTCGCAGAGATGTCATGAGCTTTAGTCGTATCTTT
GTTCCATGA
Transcript >OphauB2|1112
ATGGACCGTGAGCCCGACTCAATCCTCTCGAATCCCCATGGCGCGCCAGCTTCGGGCCTGTATCATGTGGTGGCG
TGGGCAGCTAACGCAACGTCATTCTTTATCACGAAGCTTATAGCCCAGCCACCCCTTGAGGCTGCTTCGACGGAT
AGCCTGAGCATGGGCGCCTCTGAGCCGACGGCTCTGGCTGCGGCCGCCTCTGCTTCTTCCTCTGCCTCGGCCTCT
CTCTCGTCCGGACAGGAGACCATGATGCCGGCATCGCGCCTCTCTCTCGACGGCTCCCGAGGCCTCAGTAGCGTC
TTCAATTATGCTGTCAGCAAATGGGCCCTTTCGTGCGTCGCCATGGCCATTATCCTCAACCGCACTCACATCTTT
GCTGCCACGCGCCGCCGCTTGCATCTCCGCTGGCCTGTCAGACTGGCTGTTCGTCTGGTGCCAGTCGTGCTCCTG
ACGCTCCAAGTTCGCCGTCTTCTCCAGTCGATTCAGTGCCAGACTTCTTCAACCTTTGTCCGCATGTACTCGGCC
AACGCCACTTTTTCGCGTCCGAATCCCCTGCTCAACGCCCTCAGCTCAGCCTTGCTTCTGGGCGCCACGGACGAG
CACTCGTGCACTGCCTTTTACACAACCTTCTTCTCCAATACACCCGCTCACTCGACCCGGTTTCATGGATCGCTT
TCACTTCTGTGGCCCTTGTTTGGCACGTTTTGCCTCAGCCACCTACTCGAAACTCTCATGGCAGCCGTCCAGGGC
TTGCCCATGGTATCCCAGACGGGCATGACCCTCTTTGAGCAGTCGCTGGCTTTTGCCGAGGCTGATGCCGCTGTT
ATGAATCAACTGGGCCGCGCCGCTTTGTCCAAGGCCTCGTCGGTCTTGTCAGCCCATAGCTCGTCGGGCCTTGGC
CCTGAAATGGCGTTATCCGGCTCTGCCATACTTACGCAGGCCAATGCAGCCCCAGAGGTGCTTTTGGTGGCTTTA
CTGTCGTCAATGGCCCATATCAGTAGCCATGTTCTTGGAATATTCGACCTCCAGGCAAAACATAGGCTTTTCAAT
ACTGGCTTCTGGGCCATCTGCTTCATGGCAAGCATCATAGTCACGGCTCTTTCTTTTGACCCCGACGACACTTCC
AGTCAGGGACTACTTAGATTTCCAACAGTTTGCATCATCAGCTTTATTCCTCATGTTCTTGTCCTGGCCGGAGTT
GCCACTTGCTTGTGTATCTATTTTTTCGGCCTGCTACTTTCAGCTTTAGCCCCTCCAGTACATCGTCAGCTTCCC
CCCTTGACTTTTCGTCAACGTTTTGCTTATGCACAACGCAACATGCAGGCAAATCTGTCGATATCCGACATAAGA
ATTACGGCTGACATGGACTTTTATACCGCATTACTCAGGATGGGCTTTGCTGCCATGACCATGGCCAGTGAGGCA
GTCTATCTAAACGAGGATCGCGGTGTCAGCCTGAAGAAGCGCACTTGGTTAGAGGAGGCACGTTTACGCGATCTC
GAGGAGCTACAAAGGCGTTGTATTGGCCTCGGACTACCTGGCTCCCGCTACGATCAGATTGGCACTGTTGGTCTC
ATACCGATCAAGGACGCGTCGGTCCTCGCCTGCAACGGGTACAATAGGGAGCGCGCTGCCCAAGTTTTGCCCAAG
GGCCGCAGCGAGCGTGGTGTCCGCGTAGGCACTGGGGCGACTGAGAGGAGCTCGAGATGGATCATGGCATTGGAA
TTTCTCTTGAGCATATGGCAGCTCATGGTCCGGGTTGCCGCTTTATCTGGTCTGTGGGCTCTCGGCCTCGTGCGC
ATTCGGGCTCGTCCAGCCTGGCTGCTCTGGCTCGCCCGCCGTTCCAAGTCGGCGAATGTCGCGGGGCGGCGACAA
AGATGCTCCCAAGATGTTTCTCTGAGCGACAACCAACAGACTTCAGAATTACACCGAGATGAGCGCAGTGATTAC
GATGACGAAGAACACAAATTCAAGGGCAACGGTCTCGACGTGGAAGAAGAGTTTAGGCGGGTTAGACCAATGAGC
GACGAAGAGGCGCTCGATCAAGACTTATATGTATACTGGCTCAATGGCGGTTGGTGGGGTTCCCGCGACTCGAGT
GGCGATTTCAACCCCATGTCAGCAGAAGACGACTGGGATGCCACAAGTGTGGTCAGCGTTACCAGCGACGAGCAG
TCTTTTGGCACGGAGTGGGAGTCGGAAAGCGACGGACAAAAAACGCCCACTCAAGCGTCGCCACTGCCACGAAGC
TCGCGTGGCAACAGTCCATATGTCGATAGTCCGCTCGGGATAAACGATCTTGCGCGATTACTGCGTCCGACAAAT
CGCCAAGACCGCGAAGAGGCACTGACCCTGGCGACGCATCTGCAAACAGACAAGATTATGACGAGGGCGCGTTTT
TCGCAGCTCGACCGACTAAGGCGTGCTCGTGTCCTTGCAACGTCGGACACACGAGTCAACAGTGGCCTTGAGTCT
CTGGCGCCCTACACCAAGCTCGGCCCTGACGAGGAGGAACGCTTGCTGGAACAGCTTTTACTGTCTCATCGCCGC
CAGTCAAGGCCGAGAAACTCGACCGAGCCGCTTGAGGGCTCGTCAAGCGACGAAGCGGCTGAGGGCCGGCCGTGT
GTCGTGTGCCAGACATCGATGCGCACCATTATAGTCTGGCCGTGTCGGTGTCTGAGCTTATGCGATGATTGCCGC
GTGTCACTGGCCATGAACAATTTTGACAAGTGTGTGTGTTGTCGCAGAGATGTCATGAGCTTTAGTCGTATCTTT
GTTCCATGA
Gene >OphauB2|1112
ATGGACCGTGAGCCCGACTCAATCCTCTCGAATCCCCATGGCGCGCCAGCTTCGGGCCTGTATCATGTGGTGGCG
TGGGCAGCTAACGCAACGTCATTCTTTATCACGAAGCTTATAGCCCAGCCACCCCTTGAGGCTGCTTCGACGGAT
AGCCTGAGCATGGGCGCCTCTGAGCCGACGGCTCTGGCTGCGGCCGCCTCTGCTTCTTCCTCTGCCTCGGCCTCT
CTCTCGTCCGGACAGGAGACCATGATGCCGGCATCGCGCCTCTCTCTCGACGGCTCCCGAGGCCTCAGTAGCGTC
TTCAATTATGCTGTCAGCAAATGGGCCCTTTCGTGCGTCGCCATGGCCATTATCCTCAACCGCACTCACATCTTT
GCTGCCACGCGCCGCCGCTTGCATCTCCGCTGGCCTGTCAGACTGGCTGTTCGTCTGGTGCCAGTCGTGCTCCTG
ACGCTCCAAGTTCGCCGTCTTCTCCAGTCGATTCAGTGCCAGACTTCTTCAACCTTTGTCCGCATGTACTCGGCC
AACGCCACTTTTTCGCGTCCGAATCCCCTGCTCAACGCCCTCAGCTCAGCCTTGCTTCTGGGCGCCACGGACGAG
CACTCGTGCACTGCCTTTTACACAACCTTCTTCTCCAATACACCCGCTCACTCGACCCGGTTTCATGGATCGCTT
TCACTTCTGTGGCCCTTGTTTGGCACGTTTTGCCTCAGCCACCTACTCGAAACTCTCATGGCAGCCGTCCAGGGC
TTGCCCATGGTATCCCAGACGGGCATGACCCTCTTTGAGCAGTCGCTGGCTTTTGCCGAGGCTGATGCCGCTGTT
ATGAATCAACTGGGCCGCGCCGCTTTGTCCAAGGCCTCGTCGGTCTTGTCAGCCCATAGCTCGTCGGGCCTTGGC
CCTGAAATGGCGTTATCCGGCTCTGCCATACTTACGCAGGCCAATGCAGCCCCAGAGGTGCTTTTGGTGGCTTTA
CTGTCGTCAATGGCCCATATCAGTAGCCATGTTCTTGGAATATTCGACCTCCAGGCAAAACATAGGCTTTTCAAT
ACTGGCTTCTGGGCCATCTGCTTCATGGCAAGCATCATAGTCACGGCTCTTTCTTTTGACCCCGACGACACTTCC
AGTCAGGGACTACTTAGATTTCCAACAGTTTGCATCATCAGCTTTATTCCTCATGTTCTTGTCCTGGCCGGAGTT
GCCACTTGCTTGTGTATCTATTTTTTCGGCCTGCTACTTTCAGCTTTAGCCCCTCCAGTACATCGTCAGCTTCCC
CCCTTGACTTTTCGTCAACGTTTTGCTTATGCACAACGCAACATGCAGGCAAATCTGTCGATATCCGACATAAGA
ATTACGGCTGACATGGACTTTTATACCGCATTACTCAGGATGGGCTTTGCTGCCATGACCATGGCCAGTGAGGCA
GTCTATCTAAACGAGGATCGCGGTGTCAGCCTGAAGAAGCGCACTTGGTTAGAGGAGGCACGTTTACGCGATCTC
GAGGAGCTACAAAGGCGTTGTATTGGCCTCGGACTACCTGGCTCCCGCTACGATCAGATTGGCACTGTTGGTCTC
ATACCGATCAAGGACGCGTCGGTCCTCGCCTGCAACGGGTACAATAGGGAGCGCGCTGCCCAAGTTTTGCCCAAG
GGCCGCAGCGAGCGTGGTGTCCGCGTAGGCACTGGGGCGACTGAGAGGAGCTCGAGATGGATCATGGCATTGGAA
TTTCTCTTGAGCATATGGCAGCTCATGGTCCGGGTTGCCGCTTTATCTGGTCTGTGGGCTCTCGGCCTCGTGCGC
ATTCGGGCTCGTCCAGCCTGGCTGCTCTGGCTCGCCCGCCGTTCCAAGTCGGCGAATGTCGCGGGGCGGCGACAA
AGATGCTCCCAAGATGTTTCTCTGAGCGACAACCAACAGACTTCAGAATTACACCGAGATGAGCGCAGTGATTAC
GATGACGAAGAACACAAATTCAAGGGCAACGGTCTCGACGTGGAAGAAGAGTTTAGGCGGGTTAGACCAATGAGC
GACGAAGAGGCGCTCGATCAAGACTTATATGTATACTGGCTCAATGGCGGTTGGTGGGGTTCCCGCGACTCGAGT
GGCGATTTCAACCCCATGTCAGCAGAAGACGACTGGGATGCCACAAGTGTGGTCAGCGTTACCAGCGACGAGCAG
TCTTTTGGCACGGAGTGGGAGTCGGAAAGCGACGGACAAAAAACGCCCACTCAAGCGTCGCCACTGCCACGAAGC
TCGCGTGGCAACAGTCCATATGTCGATAGTCCGCTCGGGATAAACGATCTTGCGCGATTACTGCGTCCGACAAAT
CGCCAAGACCGCGAAGAGGCACTGACCCTGGCGACGCATCTGCAAACAGACAAGATTATGACGAGGGCGCGTTTT
TCGCAGCTCGACCGACTAAGGCGTGCTCGTGTCCTTGCAACGTCGGACACACGAGTCAACAGTGGCCTTGAGTCT
CTGGCGCCCTACACCAAGCTCGGCCCTGACGAGGAGGAACGCTTGCTGGAACAGCTTTTACTGTCTCATCGCCGC
CAGTCAAGGCCGAGAAACTCGACCGAGCCGCTTGAGGGCTCGTCAAGCGACGAAGCGGCTGAGGGCCGGCCGTGT
GTCGTGTGCCAGACATCGATGCGCACCATTATAGTCTGGCCGTGTCGGTGTCTGAGCTTATGCGATGATTGCCGC
GTGTCACTGGCCATGAACAATTTTGACAAGTGTGTGTGTTGTCGCAGAGATGTCATGAGCTTTAGTCGTATCTTT
GTTCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail