Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1106
Gene name
LocationContig_126:47776..50698
Strand+
Gene length (bp)2922
Transcript length (bp)2742
Coding sequence length (bp)2742
Protein length (aa) 914

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 1.9E-07 12 122

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2343
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1086
Ophiocordyceps australis map64 (Brazil) OphauB2|1106 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01733
Ophiocordyceps camponoti-rufipedis Ophun1|3088
Ophiocordyceps kimflemingae Ophio5|7467
Ophiocordyceps subramaniannii Hirsu2|3220

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1106
MSLNGLEDGSVSEALDTVLSDPEAWLLLNYASRDQVAVLRQGKEGIAEMRSAISKHSESSPLYGLLRYGSKRVVV
KYLPDDCSRLIRARVAVHFEAVCERFTPYETTIEITSADHLTDSRLASACCLHSPSASVSSSTWSRRRRLTETLD
DESAAQGATKRQSLASESAAGSAVLVESVKLDSLLASSPEHSKFSADSTAELPMFVGADSRPISPAKSSDADSAM
SYLYAKHRVKLAPRPSLDVNGRPQTAGNFRPVSAIPAGFKLFGKGSKKDKSKKQEAGVELAIAEEKAVRPATSSG
LVQDGSTASAAKKATLSPEKMRLIKAMKLREKNKKKRDHGAVEAVDRGQQQDSVDATRAAMHVAQADSRPASPVA
APSEADDSTKPSSLSESTDGTVGAKDDEAQTSSQQHGPSSPGGMTDCNRAEHQGQPGEGEATQQEGGPEEQEGGP
EEQEGGPEEHVGGEEQVGGEEHIAGEEQVAGEEHIAGDGQLPPSVSHLLDDEHLMQELQSATVEQAKSMPVSAGL
CADTTMARQQAPRTASNPVRTQAAGAPQAPARSLSSGAPANLAKKSNIGSSISQRIKALEKLSGTAGEAVPASSL
LSAPASRERPSSTFFAVKRSPSVADRAGLLRPDAPAAAAEPPGSVTRRLGVFEPPPGSKADSVSVTAKIVGRDSA
DEGQLKQSPLLVNHHVATPGPDDEPHDDCRNRLSSSLAMAKDWSKPQNSTLGSRRSVSSRRSSASLSTADAQSLA
DDARSAAGDKKLSRAGRFMRRLSTLSGSRSKSAAAGLAEAVAEEEAQRQASPTIVSYMGDVNVQFPDNLLWKRRN
MCLDSQGFLVLGVLPAQTTRQAHASKRYHLSQFRAPYMPDVEVQELPNSVVLDFVHGTSIQVACEDRAGQQNVLD
ILQEAHASVTASA*
Coding >OphauB2|1106
ATGTCACTCAATGGGCTCGAGGATGGCAGCGTCAGCGAGGCGCTCGACACTGTCCTATCGGACCCCGAAGCATGG
CTTCTCCTAAATTACGCCTCGCGTGACCAGGTGGCTGTTCTGAGACAAGGCAAAGAGGGCATTGCGGAGATGCGC
AGCGCCATTTCCAAGCACAGTGAATCGAGTCCTCTCTACGGCTTGTTGCGATACGGCAGCAAACGGGTCGTGGTC
AAATACCTGCCTGACGACTGCTCACGGCTCATTCGAGCTCGAGTGGCTGTTCATTTCGAAGCCGTGTGCGAACGA
TTTACTCCGTACGAGACGACGATTGAAATCACAAGCGCAGACCACCTCACAGACTCGAGGCTTGCTTCGGCCTGC
TGCTTGCACTCGCCCTCGGCTTCCGTCTCATCGTCGACGTGGTCGCGGAGGAGGCGCCTGACAGAGACTCTTGAC
GACGAGTCGGCGGCACAAGGGGCCACGAAGCGCCAATCGCTTGCAAGCGAGTCGGCAGCTGGCAGCGCTGTGCTT
GTCGAGTCGGTCAAGCTCGACTCGCTCCTCGCCTCGTCACCCGAGCACAGCAAATTCTCTGCCGACTCAACCGCT
GAGCTGCCCATGTTTGTGGGCGCCGACAGCAGGCCCATTTCGCCGGCAAAGTCGAGCGACGCAGACTCGGCCATG
TCGTACTTGTATGCCAAACACAGGGTCAAGCTGGCTCCACGGCCATCTCTCGACGTCAACGGACGACCGCAGACG
GCGGGCAATTTCCGTCCCGTTTCTGCCATACCCGCCGGCTTCAAGCTCTTTGGCAAAGGAAGCAAAAAGGACAAG
AGCAAGAAACAAGAGGCTGGCGTCGAGCTGGCGATTGCCGAGGAGAAGGCTGTCAGGCCGGCCACGAGCTCTGGC
CTGGTGCAAGATGGATCGACAGCGTCAGCGGCCAAGAAGGCTACGCTCTCGCCCGAAAAGATGCGCCTCATCAAG
GCCATGAAGCTGAGGGAGAAGAATAAGAAGAAGAGGGACCATGGGGCGGTTGAGGCAGTGGACCGAGGGCAGCAA
CAAGACAGTGTCGATGCCACTCGAGCAGCAATGCATGTGGCACAGGCAGACTCGCGGCCGGCCAGTCCAGTGGCG
GCTCCTTCAGAGGCGGACGACTCGACCAAGCCGTCGTCTCTCTCCGAGTCGACAGACGGGACGGTGGGCGCAAAG
GACGACGAGGCACAGACCAGCTCGCAGCAGCATGGCCCCAGCTCGCCAGGCGGCATGACAGATTGCAACAGGGCT
GAGCATCAAGGACAGCCGGGCGAGGGGGAGGCGACGCAGCAAGAGGGGGGTCCCGAGGAGCAAGAGGGGGGGCCC
GAGGAGCAAGAGGGGGGGCCCGAGGAGCATGTTGGTGGCGAGGAGCAAGTTGGTGGCGAGGAGCATATTGCTGGC
GAGGAGCAAGTTGCTGGCGAGGAGCATATTGCTGGCGACGGGCAGCTGCCGCCGTCAGTCTCGCACCTGCTCGAC
GACGAGCATCTGATGCAAGAGCTTCAGAGCGCGACTGTGGAGCAGGCCAAGTCGATGCCAGTGTCGGCCGGCCTC
TGTGCCGACACCACAATGGCGCGCCAACAAGCCCCTCGCACCGCTTCCAACCCCGTCAGGACGCAGGCAGCTGGC
GCGCCTCAAGCCCCGGCACGCTCGCTCAGCTCTGGTGCGCCGGCCAATCTGGCCAAGAAGAGCAACATTGGGTCA
AGCATCTCGCAGCGCATCAAGGCATTGGAGAAGCTATCCGGCACGGCGGGAGAGGCGGTGCCAGCGTCGAGCTTG
CTGTCGGCACCGGCATCACGCGAACGGCCGTCGTCTACATTTTTTGCCGTCAAGCGGTCGCCGTCGGTGGCAGAC
AGGGCCGGTTTGCTGCGCCCAGACGCACCCGCTGCGGCTGCCGAGCCACCAGGCTCCGTCACCAGGCGCCTGGGC
GTGTTTGAGCCGCCGCCCGGCAGCAAGGCCGACTCGGTCTCGGTCACGGCCAAGATTGTTGGCCGCGACAGTGCC
GACGAGGGCCAGCTGAAGCAGTCGCCGCTGCTCGTCAACCACCACGTGGCAACGCCAGGGCCCGACGACGAGCCG
CACGACGACTGCAGGAACCGCCTCTCGTCGTCTCTCGCCATGGCCAAGGACTGGTCCAAGCCCCAGAATAGCACC
CTTGGGTCGCGCCGCTCCGTCAGCAGCCGCCGCTCCTCGGCCAGCCTGTCGACGGCTGATGCGCAGAGCCTGGCC
GACGACGCGAGGTCGGCTGCCGGAGACAAGAAGCTGTCGCGCGCCGGCCGCTTTATGCGCCGCCTGTCCACCCTG
TCGGGCTCGCGCAGCAAGAGCGCAGCCGCTGGCCTGGCCGAGGCTGTGGCTGAAGAGGAAGCCCAGCGCCAAGCC
TCGCCCACCATTGTCTCCTACATGGGCGATGTCAATGTGCAGTTTCCCGACAACCTGCTGTGGAAGCGCCGAAAC
ATGTGCCTCGACTCTCAAGGCTTCCTCGTCCTTGGCGTCCTGCCCGCCCAGACCACCCGCCAGGCCCACGCATCC
AAGCGCTACCACTTGAGCCAGTTCCGCGCCCCATATATGCCCGACGTCGAGGTCCAGGAGCTTCCCAACAGCGTT
GTCCTCGACTTTGTCCATGGCACCAGCATCCAGGTAGCATGCGAGGACCGCGCCGGCCAGCAGAATGTCCTTGAT
ATATTGCAAGAGGCACATGCTTCAGTCACCGCCTCGGCATAG
Transcript >OphauB2|1106
ATGTCACTCAATGGGCTCGAGGATGGCAGCGTCAGCGAGGCGCTCGACACTGTCCTATCGGACCCCGAAGCATGG
CTTCTCCTAAATTACGCCTCGCGTGACCAGGTGGCTGTTCTGAGACAAGGCAAAGAGGGCATTGCGGAGATGCGC
AGCGCCATTTCCAAGCACAGTGAATCGAGTCCTCTCTACGGCTTGTTGCGATACGGCAGCAAACGGGTCGTGGTC
AAATACCTGCCTGACGACTGCTCACGGCTCATTCGAGCTCGAGTGGCTGTTCATTTCGAAGCCGTGTGCGAACGA
TTTACTCCGTACGAGACGACGATTGAAATCACAAGCGCAGACCACCTCACAGACTCGAGGCTTGCTTCGGCCTGC
TGCTTGCACTCGCCCTCGGCTTCCGTCTCATCGTCGACGTGGTCGCGGAGGAGGCGCCTGACAGAGACTCTTGAC
GACGAGTCGGCGGCACAAGGGGCCACGAAGCGCCAATCGCTTGCAAGCGAGTCGGCAGCTGGCAGCGCTGTGCTT
GTCGAGTCGGTCAAGCTCGACTCGCTCCTCGCCTCGTCACCCGAGCACAGCAAATTCTCTGCCGACTCAACCGCT
GAGCTGCCCATGTTTGTGGGCGCCGACAGCAGGCCCATTTCGCCGGCAAAGTCGAGCGACGCAGACTCGGCCATG
TCGTACTTGTATGCCAAACACAGGGTCAAGCTGGCTCCACGGCCATCTCTCGACGTCAACGGACGACCGCAGACG
GCGGGCAATTTCCGTCCCGTTTCTGCCATACCCGCCGGCTTCAAGCTCTTTGGCAAAGGAAGCAAAAAGGACAAG
AGCAAGAAACAAGAGGCTGGCGTCGAGCTGGCGATTGCCGAGGAGAAGGCTGTCAGGCCGGCCACGAGCTCTGGC
CTGGTGCAAGATGGATCGACAGCGTCAGCGGCCAAGAAGGCTACGCTCTCGCCCGAAAAGATGCGCCTCATCAAG
GCCATGAAGCTGAGGGAGAAGAATAAGAAGAAGAGGGACCATGGGGCGGTTGAGGCAGTGGACCGAGGGCAGCAA
CAAGACAGTGTCGATGCCACTCGAGCAGCAATGCATGTGGCACAGGCAGACTCGCGGCCGGCCAGTCCAGTGGCG
GCTCCTTCAGAGGCGGACGACTCGACCAAGCCGTCGTCTCTCTCCGAGTCGACAGACGGGACGGTGGGCGCAAAG
GACGACGAGGCACAGACCAGCTCGCAGCAGCATGGCCCCAGCTCGCCAGGCGGCATGACAGATTGCAACAGGGCT
GAGCATCAAGGACAGCCGGGCGAGGGGGAGGCGACGCAGCAAGAGGGGGGTCCCGAGGAGCAAGAGGGGGGGCCC
GAGGAGCAAGAGGGGGGGCCCGAGGAGCATGTTGGTGGCGAGGAGCAAGTTGGTGGCGAGGAGCATATTGCTGGC
GAGGAGCAAGTTGCTGGCGAGGAGCATATTGCTGGCGACGGGCAGCTGCCGCCGTCAGTCTCGCACCTGCTCGAC
GACGAGCATCTGATGCAAGAGCTTCAGAGCGCGACTGTGGAGCAGGCCAAGTCGATGCCAGTGTCGGCCGGCCTC
TGTGCCGACACCACAATGGCGCGCCAACAAGCCCCTCGCACCGCTTCCAACCCCGTCAGGACGCAGGCAGCTGGC
GCGCCTCAAGCCCCGGCACGCTCGCTCAGCTCTGGTGCGCCGGCCAATCTGGCCAAGAAGAGCAACATTGGGTCA
AGCATCTCGCAGCGCATCAAGGCATTGGAGAAGCTATCCGGCACGGCGGGAGAGGCGGTGCCAGCGTCGAGCTTG
CTGTCGGCACCGGCATCACGCGAACGGCCGTCGTCTACATTTTTTGCCGTCAAGCGGTCGCCGTCGGTGGCAGAC
AGGGCCGGTTTGCTGCGCCCAGACGCACCCGCTGCGGCTGCCGAGCCACCAGGCTCCGTCACCAGGCGCCTGGGC
GTGTTTGAGCCGCCGCCCGGCAGCAAGGCCGACTCGGTCTCGGTCACGGCCAAGATTGTTGGCCGCGACAGTGCC
GACGAGGGCCAGCTGAAGCAGTCGCCGCTGCTCGTCAACCACCACGTGGCAACGCCAGGGCCCGACGACGAGCCG
CACGACGACTGCAGGAACCGCCTCTCGTCGTCTCTCGCCATGGCCAAGGACTGGTCCAAGCCCCAGAATAGCACC
CTTGGGTCGCGCCGCTCCGTCAGCAGCCGCCGCTCCTCGGCCAGCCTGTCGACGGCTGATGCGCAGAGCCTGGCC
GACGACGCGAGGTCGGCTGCCGGAGACAAGAAGCTGTCGCGCGCCGGCCGCTTTATGCGCCGCCTGTCCACCCTG
TCGGGCTCGCGCAGCAAGAGCGCAGCCGCTGGCCTGGCCGAGGCTGTGGCTGAAGAGGAAGCCCAGCGCCAAGCC
TCGCCCACCATTGTCTCCTACATGGGCGATGTCAATGTGCAGTTTCCCGACAACCTGCTGTGGAAGCGCCGAAAC
ATGTGCCTCGACTCTCAAGGCTTCCTCGTCCTTGGCGTCCTGCCCGCCCAGACCACCCGCCAGGCCCACGCATCC
AAGCGCTACCACTTGAGCCAGTTCCGCGCCCCATATATGCCCGACGTCGAGGTCCAGGAGCTTCCCAACAGCGTT
GTCCTCGACTTTGTCCATGGCACCAGCATCCAGGTAGCATGCGAGGACCGCGCCGGCCAGCAGAATGTCCTTGAT
ATATTGCAAGAGGCACATGCTTCAGTCACCGCCTCGGCATAG
Gene >OphauB2|1106
ATGTCACTCAATGGGCTCGAGGATGGCAGCGTCAGCGAGGCGCTCGACACTGTCCTATCGGACCCCGAAGCATGG
TATGTGAGAGTGTGCCGGGTGACAGAATACATGGCTGATGGCTTGATGCGACAGGCTTCTCCTAAATTACGCCTC
GCGTGACCAGGTGGCTGTTCTGAGACAAGGCAAAGAGGGCATTGCGGAGATGCGCAGCGCCATTTCCAAGCACAG
TGAATCGAGTCCTCTCTACGGCTTGTTGCGATACGGCAGCAAACGGGTCGTGGTCAAATACCTGCCTGACGACTG
CTCACGGCTCATTCGAGGTTGGTCCCTGGCTGGTAAAGGCTTTTTTTTGGGGGGCAGAGGATTGACAGCTAGACT
TGGTGACAGCTCGAGTGGCTGTTCATTTCGAAGCCGTGTGCGAACGATTTACTCCGTACGAGACGACGATTGAAA
TCACAAGCGCAGACCACCTCACAGACTCGAGGCTTGCTTCGGCCTGCTGCTTGCACTCGCCCTCGGCTTCCGTCT
CATCGTCGACGTGGTCGCGGAGGAGGCGCCTGACAGAGACTCTTGACGACGAGTCGGCGGCACAAGGGGCCACGA
AGCGCCAATCGCTTGCAAGCGAGTCGGCAGCTGGCAGCGCTGTGCTTGTCGAGTCGGTCAAGCTCGACTCGCTCC
TCGCCTCGTCACCCGAGCACAGCAAATTCTCTGCCGACTCAACCGCTGAGCTGCCCATGTTTGTGGGCGCCGACA
GCAGGCCCATTTCGCCGGCAAAGTCGAGCGACGCAGACTCGGCCATGTCGTACTTGTATGCCAAACACAGGGTCA
AGCTGGCTCCACGGCCATCTCTCGACGTCAACGGACGACCGCAGACGGCGGGCAATTTCCGTCCCGTTTCTGCCA
TACCCGCCGGCTTCAAGCTCTTTGGCAAAGGAAGCAAAAAGGACAAGAGCAAGAAACAAGAGGCTGGCGTCGAGC
TGGCGATTGCCGAGGAGAAGGCTGTCAGGCCGGCCACGAGCTCTGGCCTGGTGCAAGATGGATCGACAGCGTCAG
CGGCCAAGAAGGCTACGCTCTCGCCCGAAAAGATGCGCCTCATCAAGGCCATGAAGCTGAGGGAGAAGAATAAGA
AGAAGAGGGACCATGGGGCGGTTGAGGCAGTGGACCGAGGGCAGCAACAAGACAGTGTCGATGCCACTCGAGCAG
CAATGCATGTGGCACAGGCAGACTCGCGGCCGGCCAGTCCAGTGGCGGCTCCTTCAGAGGCGGACGACTCGACCA
AGCCGTCGTCTCTCTCCGAGTCGACAGACGGGACGGTGGGCGCAAAGGACGACGAGGCACAGACCAGCTCGCAGC
AGCATGGCCCCAGCTCGCCAGGCGGCATGACAGATTGCAACAGGGCTGAGCATCAAGGACAGCCGGGCGAGGGGG
AGGCGACGCAGCAAGAGGGGGGTCCCGAGGAGCAAGAGGGGGGGCCCGAGGAGCAAGAGGGGGGGCCCGAGGAGC
ATGTTGGTGGCGAGGAGCAAGTTGGTGGCGAGGAGCATATTGCTGGCGAGGAGCAAGTTGCTGGCGAGGAGCATA
TTGCTGGCGACGGGCAGCTGCCGCCGTCAGTCTCGCACCTGCTCGACGACGAGCATCTGATGCAAGAGCTTCAGA
GCGCGACTGTGGAGCAGGCCAAGTCGATGCCAGTGTCGGCCGGCCTCTGTGCCGACACCACAATGGCGCGCCAAC
AAGCCCCTCGCACCGCTTCCAACCCCGTCAGGACGCAGGCAGCTGGCGCGCCTCAAGCCCCGGCACGCTCGCTCA
GCTCTGGTGCGCCGGCCAATCTGGCCAAGAAGAGCAACATTGGGTCAAGCATCTCGCAGCGCATCAAGGCATTGG
AGAAGCTATCCGGCACGGCGGGAGAGGCGGTGCCAGCGTCGAGCTTGCTGTCGGCACCGGCATCACGCGAACGGC
CGTCGTCTACATTTTTTGCCGTCAAGCGGTCGCCGTCGGTGGCAGACAGGGCCGGTTTGCTGCGCCCAGACGCAC
CCGCTGCGGCTGCCGAGCCACCAGGCTCCGTCACCAGGCGCCTGGGCGTGTTTGAGCCGCCGCCCGGCAGCAAGG
CCGACTCGGTCTCGGTCACGGCCAAGATTGTTGGCCGCGACAGTGCCGACGAGGGCCAGCTGAAGCAGTCGCCGC
TGCTCGTCAACCACCACGTGGCAACGCCAGGGCCCGACGACGAGCCGCACGACGACTGCAGGAACCGCCTCTCGT
CGTCTCTCGCCATGGCCAAGGACTGGTCCAAGCCCCAGAATAGCACCCTTGGGTCGCGCCGCTCCGTCAGCAGCC
GCCGCTCCTCGGCCAGCCTGTCGACGGCTGATGCGCAGAGCCTGGCCGACGACGCGAGGTCGGCTGCCGGAGACA
AGAAGCTGTCGCGCGCCGGCCGCTTTATGCGCCGCCTGTCCACCCTGTCGGGCTCGCGCAGCAAGAGCGCAGCCG
CTGGCCTGGCCGAGGCTGTGGCTGAAGAGGAAGCCCAGCGCCAAGCCTCGCCCACCATTGTCTCCTACATGGGCG
ATGTCAATGTGCAGTTTCCCGACAACCTGCTGTGGAAGCGCCGAAACATGTGCCTCGACTCTCAAGGCTTCCTCG
TCCTTGGCGTCCTGCCCGCCCAGACCACCCGCCAGGCCCACGCATCCAAGCGCTACCACTTGAGCCAGTTCCGCG
CCCCATATATGCCCGACGTCGAGGTCCAGGAGCTTCCCAACAGCGTTGTCCTCGACTTTGTCCATGGCACCAGCA
TCCAGGTAGCATGCGAGGACCGCGCCGGCCAGCAGAATGTCCTTGATAGTAAGTCTTGACTCTTGCCCCGTCGCC
CAACTTGCTTGACTGACGCTGTCTCACTCAGTATTGCAAGAGGCACATGCTTCAGTCACCGCCTCGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail