Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1105
Gene name
LocationContig_126:44538..46439
Strand+
Gene length (bp)1901
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 3.4E-07 146 269
PF00481 PP2C Protein phosphatase 2C 9.8E-52 300 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 369 513 5.0E-59
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 372 514 1.0E-43
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 374 516 4.0E-37
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 374 516 2.0E-34
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 374 514 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 369 513 5.0E-59
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 372 514 1.0E-43
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 374 516 4.0E-37
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 374 516 2.0E-34
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 374 514 3.0E-34
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 374 514 9.0E-34
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 354 514 2.0E-32
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 374 514 4.0E-31
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 374 514 2.0E-30
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 374 513 8.0E-30
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 374 513 2.0E-28
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 374 513 3.0E-28
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 374 516 1.0E-27
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 374 513 2.0E-27
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 374 513 4.0E-27
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 374 516 8.0E-27
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 372 514 1.0E-26
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 374 513 2.0E-26
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 374 513 5.0E-26
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 374 513 2.0E-25
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 374 514 3.0E-25
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 372 513 4.0E-25
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 374 513 5.0E-25
sp|P36993|PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=1 SV=1 374 513 2.0E-24
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 372 515 2.0E-24
sp|Q6AUQ4|P2C47_ORYSJ Probable protein phosphatase 2C 47 OS=Oryza sativa subsp. japonica GN=Os05g0134200 PE=2 SV=1 372 514 5.0E-24
sp|P35815|PPM1B_RAT Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm1b PE=2 SV=1 374 547 9.0E-24
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 136 271 1.0E-23
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 375 561 1.0E-23
sp|O62830|PPM1B_BOVIN Protein phosphatase 1B OS=Bos taurus GN=PPM1B PE=2 SV=2 374 513 1.0E-23
sp|Q69VD9|P2C57_ORYSJ Probable protein phosphatase 2C 57 OS=Oryza sativa subsp. japonica GN=Os06g0597200 PE=2 SV=1 372 513 2.0E-23
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 372 515 3.0E-23
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 372 514 3.0E-23
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 372 528 3.0E-23
sp|O75688|PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens GN=PPM1B PE=1 SV=1 374 513 4.0E-23
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 372 520 4.0E-23
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 375 513 6.0E-23
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 374 511 6.0E-23
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 375 513 6.0E-23
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 375 513 6.0E-23
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 375 513 6.0E-23
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 368 513 7.0E-23
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 372 513 8.0E-23
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 372 516 1.0E-22
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 374 516 1.0E-22
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 374 511 2.0E-22
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 372 513 2.0E-22
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 374 515 2.0E-22
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 372 513 3.0E-22
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 372 513 7.0E-22
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 370 515 7.0E-22
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 370 515 7.0E-22
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 370 515 7.0E-22
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 374 511 8.0E-22
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 370 515 8.0E-22
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 370 515 9.0E-22
sp|A0DSB3|PP2C6_PARTE Probable protein phosphatase 2C 6 OS=Paramecium tetraurelia GN=GSPATT00019634001 PE=3 SV=1 372 513 1.0E-21
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 374 513 2.0E-21
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 372 513 2.0E-21
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 374 513 2.0E-21
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 374 513 2.0E-21
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 370 513 3.0E-21
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 374 481 3.0E-21
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 372 513 3.0E-21
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 374 513 3.0E-21
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 374 515 5.0E-21
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 372 513 6.0E-21
sp|Q9LUU7|P2C43_ARATH Probable protein phosphatase 2C 43 OS=Arabidopsis thaliana GN=At3g17250 PE=2 SV=1 372 522 7.0E-21
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 374 519 1.0E-20
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 374 515 1.0E-20
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 374 513 2.0E-20
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 374 481 2.0E-20
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 374 483 2.0E-20
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 372 490 3.0E-20
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 371 514 3.0E-20
sp|Q6ETK3|P2C11_ORYSJ Probable protein phosphatase 2C 11 OS=Oryza sativa subsp. japonica GN=Os02g0180000 PE=2 SV=1 374 519 4.0E-20
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 374 514 5.0E-20
sp|P39966|PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC2 PE=1 SV=1 373 514 5.0E-20
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 374 513 6.0E-20
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 374 511 7.0E-20
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 374 514 8.0E-20
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 374 517 9.0E-20
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 374 481 2.0E-19
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 374 511 2.0E-19
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 332 513 2.0E-19
sp|P36982|PP2C_LEICH Protein phosphatase 2C OS=Leishmania chagasi PE=2 SV=1 374 516 2.0E-19
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 372 513 3.0E-19
sp|Q84JI0|P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica GN=Os03g0268600 PE=2 SV=1 372 481 4.0E-19
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 374 498 6.0E-19
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 374 481 7.0E-19
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 126 271 8.0E-19
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 373 513 9.0E-19
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 374 513 9.0E-19
sp|Q54T01|Y2105_DICDI Probable protein phosphatase DDB_G0282105 OS=Dictyostelium discoideum GN=DDB_G0282105 PE=3 SV=1 372 513 2.0E-18
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 373 513 3.0E-18
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 329 513 4.0E-18
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 373 513 4.0E-18
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 372 481 7.0E-18
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 374 528 9.0E-18
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 374 513 9.0E-18
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 374 513 1.0E-17
sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=1 SV=1 374 511 1.0E-17
sp|P49598|P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1 374 481 2.0E-17
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 374 515 2.0E-17
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 374 514 3.0E-17
sp|Q6L4R7|P2C53_ORYSJ Probable protein phosphatase 2C 53 OS=Oryza sativa subsp. japonica GN=Os05g0592800 PE=2 SV=1 374 481 4.0E-17
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 374 513 5.0E-17
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 374 515 5.0E-17
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 374 515 6.0E-17
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 374 481 1.0E-16
sp|Q9CAJ0|P2C16_ARATH Protein phosphatase 2C 16 OS=Arabidopsis thaliana GN=HAB1 PE=1 SV=1 374 481 1.0E-16
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 373 514 2.0E-16
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 370 514 3.0E-16
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 373 514 4.0E-16
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 374 513 4.0E-16
sp|Q54WS9|Y9461_DICDI Probable protein phosphatase DDB_G0279461 OS=Dictyostelium discoideum GN=DDB_G0279461 PE=3 SV=2 372 511 4.0E-16
sp|Q8N819|PPM1N_HUMAN Probable protein phosphatase 1N OS=Homo sapiens GN=PPM1N PE=2 SV=2 372 522 5.0E-16
sp|Q8BGL1|PPM1N_MOUSE Probable protein phosphatase 1N OS=Mus musculus GN=Ppm1n PE=2 SV=1 372 540 1.0E-15
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 374 541 2.0E-15
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 378 513 2.0E-15
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 374 510 3.0E-15
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 374 497 1.0E-14
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 374 514 1.0E-14
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 374 515 3.0E-14
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 373 510 8.0E-14
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 374 529 2.0E-13
sp|Q7XP01|P2C37_ORYSJ Probable protein phosphatase 2C 37 OS=Oryza sativa subsp. japonica GN=Os04g0167900 PE=3 SV=2 374 482 3.0E-13
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 356 513 4.0E-13
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 374 513 4.0E-13
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 356 513 4.0E-13
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 374 511 6.0E-13
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 374 522 1.0E-12
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 374 513 2.0E-12
sp|P38089|PP2C4_YEAST Protein phosphatase 2C homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC4 PE=1 SV=1 374 511 3.0E-12
sp|Q9M9W9|P2C34_ARATH Probable protein phosphatase 2C 34 OS=Arabidopsis thaliana GN=At3g05640 PE=2 SV=1 373 498 3.0E-12
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 374 515 5.0E-12
sp|P49594|FEM2_CAEEL Ca(2+)/calmodulin-dependent protein kinase phosphatase OS=Caenorhabditis elegans GN=fem-2 PE=1 SV=2 372 510 5.0E-12
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 373 482 6.0E-12
sp|Q3EAZ3|P2C45_ARATH Putative protein phosphatase 2C-like protein 45 OS=Arabidopsis thaliana GN=At3g27140 PE=5 SV=1 410 542 7.0E-12
sp|Q9SUF4|P2C53_ARATH Putative protein phosphatase 2C 53 OS=Arabidopsis thaliana GN=At4g08260 PE=5 SV=1 421 511 8.0E-12
sp|Q0WRB2|P2C73_ARATH Probable protein phosphatase 2C 73 OS=Arabidopsis thaliana GN=PPC6-7 PE=2 SV=1 369 498 1.0E-11
sp|Q9SD12|P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana GN=At3g51370 PE=2 SV=1 373 482 1.0E-11
sp|Q9LW60|P2C44_ARATH Putative protein phosphatase 2C-like protein 44 OS=Arabidopsis thaliana GN=At3g23360 PE=5 SV=1 374 513 1.0E-11
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 372 513 2.0E-11
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 372 501 2.0E-10
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 374 522 2.0E-10
sp|Q6K5I0|P2C20_ORYSJ Probable protein phosphatase 2C 20 OS=Oryza sativa subsp. japonica GN=Os02g0600000 PE=3 SV=2 374 516 2.0E-10
sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza sativa subsp. japonica GN=Os06g0717800 PE=2 SV=1 373 482 5.0E-10
sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryza sativa subsp. japonica GN=Os10g0544900 PE=2 SV=1 374 482 5.0E-10
sp|A8MPX8|PP2D1_HUMAN Protein phosphatase 2C-like domain-containing protein 1 OS=Homo sapiens GN=PP2D1 PE=2 SV=2 373 479 6.0E-10
sp|O15297|PPM1D_HUMAN Protein phosphatase 1D OS=Homo sapiens GN=PPM1D PE=1 SV=1 374 524 2.0E-09
sp|P46014|P2C70_ARATH Protein phosphatase 2C 70 OS=Arabidopsis thaliana GN=KAPP PE=1 SV=2 377 513 2.0E-09
sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza sativa subsp. japonica GN=Os07g0566200 PE=2 SV=2 374 574 2.0E-09
sp|Q9FKX4|P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana GN=At5g66080 PE=2 SV=1 374 482 2.0E-09
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 373 498 3.0E-09
sp|Q8GY60|P2C52_ARATH Probable protein phosphatase 2C 52 OS=Arabidopsis thaliana GN=At4g03415 PE=2 SV=1 374 541 3.0E-09
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 373 498 4.0E-09
sp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana GN=At4g38520 PE=2 SV=1 374 482 4.0E-09
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 373 480 6.0E-09
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 374 480 7.0E-09
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 374 511 8.0E-09
sp|Q6L482|P2C48_ORYSJ Probable protein phosphatase 2C 48 OS=Oryza sativa subsp. japonica GN=Os05g0358500 PE=2 SV=1 373 498 1.0E-08
sp|Q9QZ67|PPM1D_MOUSE Protein phosphatase 1D OS=Mus musculus GN=Ppm1d PE=2 SV=2 374 524 1.0E-08
sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryza sativa subsp. japonica GN=Os04g0584300 PE=3 SV=2 374 482 1.0E-08
sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryza sativa subsp. japonica GN=Os11g0109000 PE=2 SV=1 374 498 1.0E-08
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1 374 497 1.0E-08
sp|Q5R522|PPM1K_PONAB Protein phosphatase 1K, mitochondrial OS=Pongo abelii GN=PPM1K PE=2 SV=1 374 438 2.0E-08
sp|Q8RXZ4|P2C18_ARATH Probable protein phosphatase 2C 18 OS=Arabidopsis thaliana GN=At1g79630 PE=2 SV=1 374 511 2.0E-08
sp|Q9LR65|P2C01_ARATH Probable protein phosphatase 2C 1 OS=Arabidopsis thaliana GN=PPC6-6 PE=1 SV=1 374 501 2.0E-08
sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryza sativa subsp. japonica GN=Os02g0685600 PE=2 SV=1 373 498 2.0E-08
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 374 480 3.0E-08
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 374 482 6.0E-08
sp|A3CCP9|P2C76_ORYSJ Putative protein phosphatase 2C 76 OS=Oryza sativa subsp. japonica GN=Os11g0586001 PE=3 SV=2 395 511 7.0E-08
sp|Q8BVT6|PP2D1_MOUSE Protein phosphatase 2C-like domain-containing protein 1 OS=Mus musculus GN=Pp2d1 PE=2 SV=1 373 486 1.0E-07
sp|Q6ZKL8|P2C66_ORYSJ Probable protein phosphatase 2C 66 OS=Oryza sativa subsp. japonica GN=Os08g0500300 PE=2 SV=1 374 501 1.0E-07
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 373 516 1.0E-07
sp|Q9SA22|P2C06_ARATH Probable protein phosphatase 2C 6 OS=Arabidopsis thaliana GN=At1g16220 PE=2 SV=1 374 498 2.0E-07
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 372 493 2.0E-07
sp|Q6NKS1|P2C65_ARATH Probable protein phosphatase 2C 65 OS=Arabidopsis thaliana GN=At5g01700 PE=2 SV=1 374 503 3.0E-07
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 374 498 4.0E-07
sp|Q9FX08|P2C12_ARATH Probable protein phosphatase 2C 12 OS=Arabidopsis thaliana GN=At1g47380 PE=2 SV=1 373 515 4.0E-07
sp|Q7XTC7|P2C40_ORYSJ Probable protein phosphatase 2C 40 OS=Oryza sativa subsp. japonica GN=Os04g0449400 PE=3 SV=3 373 515 5.0E-07
sp|Q9M9C6|P2C15_ARATH Probable protein phosphatase 2C 15 OS=Arabidopsis thaliana GN=At1g68410 PE=2 SV=1 376 515 6.0E-07
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 374 484 9.0E-07
sp|Q6YTI2|P2C15_ORYSJ Probable protein phosphatase 2C 15 OS=Oryza sativa subsp. japonica GN=Os02g0567200 PE=2 SV=1 374 515 1.0E-06
sp|Q9FG61|P2C74_ARATH Probable protein phosphatase 2C 74 OS=Arabidopsis thaliana GN=At5g36250 PE=1 SV=1 374 501 2.0E-06
sp|Q6K1U4|P2C16_ORYSJ Probable protein phosphatase 2C 16 OS=Oryza sativa subsp. japonica GN=Os02g0598400 PE=2 SV=1 374 519 2.0E-06
sp|O80492|P2C05_ARATH Probable protein phosphatase 2C 5 OS=Arabidopsis thaliana GN=At1g09160 PE=2 SV=1 374 515 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1105
MFGGGSTSSAQKTEGELKAPAKPSSTEPSGSATSPSSNADQVTSGEKRSGNGSPQSRTDNGSLDKKRRSSGVGGK
ASSLLASARNSLGFSQGGRGSSDLTAHTPLQKLGKQDLALAVPQGQHNNSAGESVPGPMSSFRVGVWEDRNKKCR
RTMEDTHAFLYNFLDTPASTLVKDTGDKADAGRDDEGTHDSQMVHSDNGYFAIFDGHAGTFAADWCGKKLHIILE
DIIRKNPKASIPELLDLTFTTVDSQLERLPVKNSGCTAAIAVLRWEDRVPNEKSVTGSQPIASASTAASKHEENF
GSEMSSCPNDPLEQATNKDKDKDKDKDREKEKQTEKDKEKDKDVVFTMVTEVSDASSSISTKTKPRDPRRLRVLY
TANVGDARIILCRSGRALRLSYDHKGSDENEGKRIANAGGLILNNRVNGVLAVTRALGDAYMKDLVTGHPYTTET
VVQADLDEFIIIACDGLWDVCTDQEAVDLVRNIADATEASKALVDHALSRFSTDNLSCMIVRFLPGVAQQNQGSK
VDYKEDGSSAKVSEVEKIVMETKKKIAEGSASAVGVSPSNGGRGYDGVTAKGANHVSTSLGDLVQQQGVGSEDAG
DAQANDKTQCVVSGNT*
Coding >OphauB2|1105
ATGTTTGGCGGCGGTTCCACCTCTTCGGCGCAAAAGACTGAGGGCGAGCTCAAAGCTCCGGCCAAACCCTCTTCC
ACAGAGCCAAGCGGTAGCGCTACCAGCCCGTCCTCAAACGCGGACCAGGTCACGAGTGGGGAAAAGCGTAGCGGC
AATGGCAGCCCACAAAGCCGAACCGATAATGGCTCTTTAGACAAGAAGCGCAGGAGCAGCGGTGTTGGAGGCAAG
GCCAGCAGCCTTTTGGCCTCGGCCAGGAACTCTCTCGGCTTTTCACAGGGTGGTCGCGGAAGCTCTGATTTGACG
GCACATACGCCACTCCAGAAGCTAGGCAAGCAAGATCTGGCTCTAGCTGTACCTCAAGGCCAGCACAACAACTCT
GCGGGAGAATCAGTACCCGGACCAATGTCATCGTTTCGCGTCGGCGTTTGGGAAGATAGGAACAAGAAATGCCGC
AGAACTATGGAGGATACACATGCTTTTCTCTACAACTTTCTTGACACTCCAGCTTCCACGCTTGTCAAGGATACT
GGCGATAAAGCAGATGCAGGCCGAGACGATGAAGGCACTCACGACTCACAAATGGTGCATTCTGATAATGGCTAC
TTTGCTATATTTGATGGCCACGCCGGCACTTTTGCTGCTGACTGGTGCGGCAAGAAGCTACATATAATACTCGAG
GACATTATACGAAAAAATCCCAAGGCGTCAATTCCAGAGCTGCTCGACCTTACCTTTACCACTGTCGATTCTCAA
CTCGAGAGGCTACCTGTTAAGAATAGCGGATGCACCGCAGCCATTGCCGTTTTGCGTTGGGAAGACCGGGTCCCA
AACGAAAAGTCAGTCACGGGCTCTCAACCCATCGCCTCGGCCTCCACGGCTGCGTCGAAACATGAGGAAAACTTT
GGGAGTGAAATGTCATCTTGTCCCAACGACCCACTCGAGCAGGCCACCAATAAGGACAAGGACAAGGACAAGGAC
AAGGACAGGGAAAAAGAAAAGCAAACGGAAAAGGACAAGGAAAAGGATAAGGACGTGGTTTTTACCATGGTGACT
GAAGTATCGGATGCATCCTCGAGCATCTCAACCAAGACGAAGCCAAGGGACCCAAGGCGACTTCGCGTTCTTTAT
ACGGCCAATGTCGGAGATGCGCGCATCATATTATGTCGCAGCGGCAGAGCCCTGAGGCTATCTTATGATCACAAA
GGAAGTGACGAAAACGAGGGCAAGAGAATTGCAAACGCGGGGGGGCTTATTTTGAATAACCGTGTCAACGGCGTT
TTGGCCGTTACGCGAGCGCTCGGCGACGCTTATATGAAGGATCTCGTTACTGGCCATCCGTATACGACTGAAACT
GTAGTTCAGGCTGATCTGGACGAGTTTATCATTATTGCATGCGATGGACTGTGGGACGTGTGCACTGATCAGGAA
GCTGTTGACCTGGTGCGCAACATTGCAGACGCGACAGAGGCATCAAAAGCGCTTGTCGACCACGCGCTCAGCCGA
TTTAGCACGGATAACCTGTCGTGCATGATTGTTCGCTTCTTACCCGGGGTCGCGCAGCAGAACCAAGGCAGCAAG
GTCGACTACAAGGAAGACGGCTCGTCGGCAAAGGTCAGCGAGGTGGAAAAGATTGTGATGGAGACCAAGAAGAAA
ATCGCAGAGGGCAGCGCCAGCGCCGTGGGCGTTTCTCCAAGCAACGGCGGCCGTGGTTACGATGGTGTGACGGCC
AAGGGAGCCAATCACGTGTCGACGAGTCTGGGAGACTTGGTACAGCAACAAGGAGTAGGGAGCGAAGACGCTGGG
GACGCTCAAGCGAATGACAAGACGCAGTGTGTCGTGTCTGGAAATACCTAG
Transcript >OphauB2|1105
ATGTTTGGCGGCGGTTCCACCTCTTCGGCGCAAAAGACTGAGGGCGAGCTCAAAGCTCCGGCCAAACCCTCTTCC
ACAGAGCCAAGCGGTAGCGCTACCAGCCCGTCCTCAAACGCGGACCAGGTCACGAGTGGGGAAAAGCGTAGCGGC
AATGGCAGCCCACAAAGCCGAACCGATAATGGCTCTTTAGACAAGAAGCGCAGGAGCAGCGGTGTTGGAGGCAAG
GCCAGCAGCCTTTTGGCCTCGGCCAGGAACTCTCTCGGCTTTTCACAGGGTGGTCGCGGAAGCTCTGATTTGACG
GCACATACGCCACTCCAGAAGCTAGGCAAGCAAGATCTGGCTCTAGCTGTACCTCAAGGCCAGCACAACAACTCT
GCGGGAGAATCAGTACCCGGACCAATGTCATCGTTTCGCGTCGGCGTTTGGGAAGATAGGAACAAGAAATGCCGC
AGAACTATGGAGGATACACATGCTTTTCTCTACAACTTTCTTGACACTCCAGCTTCCACGCTTGTCAAGGATACT
GGCGATAAAGCAGATGCAGGCCGAGACGATGAAGGCACTCACGACTCACAAATGGTGCATTCTGATAATGGCTAC
TTTGCTATATTTGATGGCCACGCCGGCACTTTTGCTGCTGACTGGTGCGGCAAGAAGCTACATATAATACTCGAG
GACATTATACGAAAAAATCCCAAGGCGTCAATTCCAGAGCTGCTCGACCTTACCTTTACCACTGTCGATTCTCAA
CTCGAGAGGCTACCTGTTAAGAATAGCGGATGCACCGCAGCCATTGCCGTTTTGCGTTGGGAAGACCGGGTCCCA
AACGAAAAGTCAGTCACGGGCTCTCAACCCATCGCCTCGGCCTCCACGGCTGCGTCGAAACATGAGGAAAACTTT
GGGAGTGAAATGTCATCTTGTCCCAACGACCCACTCGAGCAGGCCACCAATAAGGACAAGGACAAGGACAAGGAC
AAGGACAGGGAAAAAGAAAAGCAAACGGAAAAGGACAAGGAAAAGGATAAGGACGTGGTTTTTACCATGGTGACT
GAAGTATCGGATGCATCCTCGAGCATCTCAACCAAGACGAAGCCAAGGGACCCAAGGCGACTTCGCGTTCTTTAT
ACGGCCAATGTCGGAGATGCGCGCATCATATTATGTCGCAGCGGCAGAGCCCTGAGGCTATCTTATGATCACAAA
GGAAGTGACGAAAACGAGGGCAAGAGAATTGCAAACGCGGGGGGGCTTATTTTGAATAACCGTGTCAACGGCGTT
TTGGCCGTTACGCGAGCGCTCGGCGACGCTTATATGAAGGATCTCGTTACTGGCCATCCGTATACGACTGAAACT
GTAGTTCAGGCTGATCTGGACGAGTTTATCATTATTGCATGCGATGGACTGTGGGACGTGTGCACTGATCAGGAA
GCTGTTGACCTGGTGCGCAACATTGCAGACGCGACAGAGGCATCAAAAGCGCTTGTCGACCACGCGCTCAGCCGA
TTTAGCACGGATAACCTGTCGTGCATGATTGTTCGCTTCTTACCCGGGGTCGCGCAGCAGAACCAAGGCAGCAAG
GTCGACTACAAGGAAGACGGCTCGTCGGCAAAGGTCAGCGAGGTGGAAAAGATTGTGATGGAGACCAAGAAGAAA
ATCGCAGAGGGCAGCGCCAGCGCCGTGGGCGTTTCTCCAAGCAACGGCGGCCGTGGTTACGATGGTGTGACGGCC
AAGGGAGCCAATCACGTGTCGACGAGTCTGGGAGACTTGGTACAGCAACAAGGAGTAGGGAGCGAAGACGCTGGG
GACGCTCAAGCGAATGACAAGACGCAGTGTGTCGTGTCTGGAAATACCTAG
Gene >OphauB2|1105
ATGTTTGGCGGCGGTTCCACCTCTTCGGCGCAAAAGACTGAGGGCGAGCTCAAAGCTCCGGCCAAACCCTCTTCC
ACAGAGCCAAGCGGTAGCGCTACCAGCCCGTCCTCAAACGCGGACCAGGTCACGAGTGGGGAAAAGCGTAGCGGC
AATGGCAGCCCACAAAGCCGAACCGATAATGGCTCTTTAGACAAGAAGCGCAGGAGCAGCGGTGTTGGAGGCAAG
GCCAGCAGCCTTTTGGCCTCGGCCAGGAACTCTCTCGGCTTTTCACAGGGTGGTCGCGGAAGCTCTGATTTGACG
GCACATACGCCACTCCAGAAGCTAGGCAAGCAAGATCTGGCTCTAGCTGTACCTCAAGGCCAGCACAACAACTCT
GCGGGAGAATCAGTACCCGGACCAATGTCATCGTTTCGCGTCGGCGTTTGGGAAGATAGGAACAAGAAATGCCGC
AGAACTATGGAGGATACACATGCTTTTCTCTACAACTTTCTTGACACTCCAGCTTCCACGCTTGTCAAGGATACT
GGCGATAAAGCAGATGCAGGCCGAGACGATGAAGGCACTCACGACTCACAAATGGTGCATTCTGATAATGGCTAC
TTTGCTATATTTGATGGCCACGCCGGCACTTTTGCTGCTGACTGGTGCGGCAAGAAGCTACATATAATACTCGAG
GACATTATACGAAAAAATCCCAAGGCGTCAATTCCAGAGCTGCTCGACCTTACCTTTACCACTGTCGATTCTCAA
CTCGAGAGGCTACCTGTTAAGAATAGCGGATGCACCGCAGCCATTGCCGTTTTGCGTTGGGAAGACCGGGTCCCA
AACGAAAAGTCAGTCACGGGCTCTCAACCCATCGCCTCGGCCTCCACGGCTGCGTCGAAACATGAGGAAAACTTT
GGGAGTGAAATGTCATCTTGTCCCAACGACCCACTCGAGCAGGCCACCAATAAGGACAAGGACAAGGACAAGGAC
AAGGACAGGGAAAAAGAAAAGCAAACGGAAAAGGACAAGGAAAAGGATAAGGACGTGGTTTTTACCATGGTGACT
GAAGTATCGGATGCATCCTCGAGCATCTCAACCAAGACGAAGCCAAGGGACCCAAGGCGACTTCGCGTTCTTTAT
ACGGCCAATGTCGGAGATGCGCGCATCATATTATGTCGCAGCGGCAGAGCCCTGAGGCTATCTTATGATCACAAA
GGAAGTGACGAAAACGAGGGCAAGAGAATTGCAAACGCGGGGGGGCTTATTTTGAATAACCGTGTCAACGGCGTT
TTGGCCGTTACGCGAGCGCTCGGCGACGCTTATATGAAGGATCTCGTTACTGGCCATCCGTATACGACTGAAACT
GTAGTTCAGGCTGATCTGGACGAGTTTATCATTATTGCATGCGATGGAGTAAGTTTGCCATGACAAAGCGTGTGA
ACAAAGTATTGACTGTAATGCAGCTGTGGGACGTGTGCACTGATCAGGAAGCTGTTGACCTGGTGCGCAACATTG
CAGACGCGACAGAGGCATCAAAAGCGCTTGTCGACCACGCGCTCAGCCGATTTAGCACGGATAACCTGTCGTGCA
TGATTGTTCGCTTCTTACCCGGGGTCGCGCAGCAGAACCAAGGCAGCAAGGTCGACTACAAGGAAGACGGCTCGT
CGGCAAAGGTCAGCGAGGTGGAAAAGATTGTGATGGAGACCAAGAAGAAAATCGCAGAGGGCAGCGCCAGCGCCG
TGGGCGTTTCTCCAAGCAACGGCGGCCGTGGTTACGATGGTGTGACGGCCAAGGGAGCCAATCACGTGTCGACGA
GTCTGGGAGACTTGGTACAGCAACAAGGAGTAGGGAGCGAAGACGCTGGGGACGCTCAAGCGAATGACAAGACGC
AGTGTGTCGTGTCTGGAAATACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail