Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1104
Gene name
LocationContig_126:42223..43077
Strand+
Gene length (bp)854
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 3.2E-34 21 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36108|DID4_YEAST DOA4-independent degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DID4 PE=1 SV=2 1 228 1.0E-74
sp|Q9SKI2|VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana GN=VPS2.1 PE=1 SV=2 3 228 3.0E-67
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 6 198 4.0E-61
sp|O14177|DID4_SCHPO ESCRT-III complex subunit did4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=did4 PE=3 SV=2 1 228 5.0E-59
sp|Q7ZW25|CHM2A_DANRE Charged multivesicular body protein 2a OS=Danio rerio GN=chmp2a PE=2 SV=1 4 228 6.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36108|DID4_YEAST DOA4-independent degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DID4 PE=1 SV=2 1 228 1.0E-74
sp|Q9SKI2|VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana GN=VPS2.1 PE=1 SV=2 3 228 3.0E-67
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 6 198 4.0E-61
sp|O14177|DID4_SCHPO ESCRT-III complex subunit did4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=did4 PE=3 SV=2 1 228 5.0E-59
sp|Q7ZW25|CHM2A_DANRE Charged multivesicular body protein 2a OS=Danio rerio GN=chmp2a PE=2 SV=1 4 228 6.0E-59
sp|Q6DFS6|CHM2A_XENTR Charged multivesicular body protein 2a OS=Xenopus tropicalis GN=chmp2a PE=2 SV=1 4 193 2.0E-57
sp|Q6IP52|CHM2A_XENLA Charged multivesicular body protein 2a OS=Xenopus laevis GN=chmp2a PE=2 SV=1 4 193 2.0E-57
sp|Q9DB34|CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus GN=Chmp2a PE=1 SV=1 4 196 6.0E-57
sp|O43633|CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens GN=CHMP2A PE=1 SV=1 4 193 3.0E-56
sp|Q5ZHN1|CHM2A_CHICK Charged multivesicular body protein 2a OS=Gallus gallus GN=CHMP2A PE=2 SV=1 4 190 7.0E-49
sp|Q941D5|VPS2C_ARATH Vacuolar protein sorting-associated protein 2 homolog 3 OS=Arabidopsis thaliana GN=VPS2.3 PE=2 SV=1 1 227 3.0E-30
sp|Q0WTY4|VPS2B_ARATH Vacuolar protein sorting-associated protein 2 homolog 2 OS=Arabidopsis thaliana GN=VPS2.2 PE=1 SV=2 1 228 3.0E-25
sp|Q6NXD2|CHM2B_DANRE Charged multivesicular body protein 2b OS=Danio rerio GN=chmp2b PE=2 SV=1 30 203 2.0E-21
sp|Q7SYR0|CH2BA_XENLA Charged multivesicular body protein 2b-A OS=Xenopus laevis GN=chmp2b-a PE=2 SV=1 30 203 2.0E-20
sp|Q66IV6|CH2BB_XENLA Charged multivesicular body protein 2b-B OS=Xenopus laevis GN=chmp2b-b PE=2 SV=1 7 203 7.0E-20
sp|Q5RAV2|CHM2B_PONAB Charged multivesicular body protein 2b OS=Pongo abelii GN=CHMP2B PE=2 SV=1 7 201 1.0E-19
sp|Q9UQN3|CHM2B_HUMAN Charged multivesicular body protein 2b OS=Homo sapiens GN=CHMP2B PE=1 SV=1 7 201 1.0E-19
sp|Q6NVL7|CHM2B_XENTR Charged multivesicular body protein 2b OS=Xenopus tropicalis GN=chmp2b PE=2 SV=1 7 203 1.0E-19
sp|Q5F3A2|CHM2B_CHICK Charged multivesicular body protein 2b OS=Gallus gallus GN=CHMP2B PE=2 SV=1 7 201 1.0E-19
sp|Q8BJF9|CHM2B_MOUSE Charged multivesicular body protein 2b OS=Mus musculus GN=Chmp2b PE=1 SV=1 7 201 3.0E-19
sp|Q3SX42|CHM2B_BOVIN Charged multivesicular body protein 2b OS=Bos taurus GN=CHMP2B PE=2 SV=1 7 199 7.0E-19
sp|Q54GK9|CM2A1_DICDI Charged multivesicular body protein 2a homolog 1 OS=Dictyostelium discoideum GN=chmp2a1 PE=3 SV=2 9 146 4.0E-16
sp|Q8CGS4|CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus GN=Chmp3 PE=1 SV=3 5 227 2.0E-10
sp|Q6NRM7|CHMP3_XENLA Charged multivesicular body protein 3 OS=Xenopus laevis GN=chmp3 PE=2 SV=3 5 198 6.0E-10
sp|Q54P63|CHMP3_DICDI Charged multivesicular body protein 3 OS=Dictyostelium discoideum GN=chmp3 PE=3 SV=1 6 151 8.0E-10
sp|Q6NY88|CHMP3_DANRE Charged multivesicular body protein 3 OS=Danio rerio GN=chmp3 PE=2 SV=3 3 194 1.0E-09
sp|Q5BKM3|CHMP3_XENTR Charged multivesicular body protein 3 OS=Xenopus tropicalis GN=chmp3 PE=2 SV=4 5 198 3.0E-09
sp|P36095|VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS24 PE=1 SV=1 18 187 4.0E-09
sp|Q9CQ10|CHMP3_MOUSE Charged multivesicular body protein 3 OS=Mus musculus GN=Chmp3 PE=1 SV=3 5 205 8.0E-09
sp|Q9Y3E7|CHMP3_HUMAN Charged multivesicular body protein 3 OS=Homo sapiens GN=CHMP3 PE=1 SV=3 5 195 2.0E-08
sp|Q5RAU5|CHMP3_PONAB Charged multivesicular body protein 3 OS=Pongo abelii GN=CHMP3 PE=2 SV=3 5 195 2.0E-08
sp|Q58CS7|CHMP3_BOVIN Charged multivesicular body protein 3 OS=Bos taurus GN=CHMP3 PE=2 SV=4 5 195 2.0E-08
sp|Q4R574|CHMP3_MACFA Charged multivesicular body protein 3 OS=Macaca fascicularis GN=CHMP3 PE=2 SV=3 5 195 8.0E-08
sp|Q9FFB3|VP241_ARATH Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana GN=VPS24-1 PE=1 SV=1 14 154 3.0E-07
sp|O60074|DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=did2 PE=3 SV=2 25 227 6.0E-07
sp|Q99LU0|CH1B1_MOUSE Charged multivesicular body protein 1b-1 OS=Mus musculus GN=Chmp1b1 PE=1 SV=1 25 195 2.0E-06
sp|Q7ZVB1|CHM1B_DANRE Charged multivesicular body protein 1b OS=Danio rerio GN=chmp1b PE=2 SV=1 25 195 3.0E-06
sp|Q7LBR1|CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens GN=CHMP1B PE=1 SV=1 25 195 4.0E-06
sp|O14296|VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps24 PE=3 SV=1 6 227 7.0E-06
sp|Q5ZKX1|CHM1B_CHICK Charged multivesicular body protein 1b OS=Gallus gallus GN=CHMP1B PE=2 SV=1 57 195 8.0E-06
sp|Q5E994|CHM1B_BOVIN Charged multivesicular body protein 1b OS=Bos taurus GN=CHMP1B PE=2 SV=1 57 195 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1104
MNILEWAFGKRITPAERLRKNQRMLDKAIRELDQTRIKLEKQEKTLIQQIKTSAKNGQMGACKIQAKDLVRTRRY
IEKFFSMRSQLQKISLRLQTYRTNEQMMQAMKGATMALGSMNKSMNLPQLQRIAMEFERENDIMEQRQEMMDDAV
DDAMDVGIEEEGDEVVDQVLEEIGVDLNQALGETPTVLGSSAVPEGRIAQAIGGGGGGGGGGDPVDDDLQARLDS
LRK*
Coding >OphauB2|1104
ATGAATATTCTTGAATGGGCTTTTGGCAAGCGCATCACACCGGCAGAACGCCTGCGCAAGAACCAACGCATGCTC
GACAAGGCCATTCGGGAACTCGACCAGACACGCATCAAGTTGGAGAAGCAAGAAAAGACACTGATACAACAGATC
AAGACAAGCGCCAAGAATGGCCAGATGGGCGCGTGCAAGATTCAGGCCAAGGATCTCGTCCGAACCCGGCGGTAC
ATTGAAAAGTTTTTTTCCATGCGGAGTCAGCTCCAAAAGATTTCTCTGCGACTACAGACATATCGCACAAATGAG
CAGATGATGCAAGCAATGAAGGGAGCAACTATGGCCCTCGGCAGCATGAACAAGTCGATGAACCTACCTCAACTC
CAGCGCATCGCCATGGAATTTGAGCGCGAAAACGATATTATGGAGCAAAGGCAAGAAATGATGGATGATGCTGTC
GATGACGCCATGGATGTAGGCATCGAGGAGGAGGGCGATGAAGTCGTTGATCAAGTCTTGGAAGAAATTGGCGTT
GACCTCAACCAAGCTCTTGGCGAAACCCCCACAGTCCTGGGAAGCTCGGCGGTACCCGAGGGCCGAATTGCACAA
GCGATAGGAGGCGGCGGCGGCGGCGGCGGCGGTGGTGATCCTGTTGACGACGACCTCCAGGCACGTCTGGACAGC
TTAAGAAAATGA
Transcript >OphauB2|1104
ATGAATATTCTTGAATGGGCTTTTGGCAAGCGCATCACACCGGCAGAACGCCTGCGCAAGAACCAACGCATGCTC
GACAAGGCCATTCGGGAACTCGACCAGACACGCATCAAGTTGGAGAAGCAAGAAAAGACACTGATACAACAGATC
AAGACAAGCGCCAAGAATGGCCAGATGGGCGCGTGCAAGATTCAGGCCAAGGATCTCGTCCGAACCCGGCGGTAC
ATTGAAAAGTTTTTTTCCATGCGGAGTCAGCTCCAAAAGATTTCTCTGCGACTACAGACATATCGCACAAATGAG
CAGATGATGCAAGCAATGAAGGGAGCAACTATGGCCCTCGGCAGCATGAACAAGTCGATGAACCTACCTCAACTC
CAGCGCATCGCCATGGAATTTGAGCGCGAAAACGATATTATGGAGCAAAGGCAAGAAATGATGGATGATGCTGTC
GATGACGCCATGGATGTAGGCATCGAGGAGGAGGGCGATGAAGTCGTTGATCAAGTCTTGGAAGAAATTGGCGTT
GACCTCAACCAAGCTCTTGGCGAAACCCCCACAGTCCTGGGAAGCTCGGCGGTACCCGAGGGCCGAATTGCACAA
GCGATAGGAGGCGGCGGCGGCGGCGGCGGCGGTGGTGATCCTGTTGACGACGACCTCCAGGCACGTCTGGACAGC
TTAAGAAAATGA
Gene >OphauB2|1104
ATGAATGCGGGTGTCTTCACTGCTCTCTCCTGCAGTCCTGGGTGCTGACTGAGGCTTAGATTCTTGAATGGGCTT
TTGGCAAGCGCATCACACCGGCAGAACGCCTGCGCAAGAACCAACGCATGCTCGACAAGGCCATTCGGGAACTCG
ACCAGACACGCATCAAGTTGGAGAAGCAAGAAAAGACACTGATACAACAGATCAAGACAAGCGCCAAGAATGGCC
AGATGGGCGCGTGCAAGATTCAGGCCAAGGATCTCGTCCGAACCCGGCGGTACATTGAAAAGTTTTTTTCCATGC
GGAGTCAGCTCCAAAAGATTTCTCTGCGACTACAGGTACCATGAGCTTGGACAGAGAAGCAGATACTGAGACTGA
CTGGGATGAAGACATATCGCACAAATGAGCAGATGATGCAAGCAATGAAGGGAGCAACTATGGCCCTCGGCAGCA
TGAACAAGTCGATGAACCTACCTCAACTCCAGCGCATCGCCATGGAATTTGAGCGCGAAAACGATATTATGGAGC
AAAGGCAAGAAATGATGGATGATGCTGTCGATGACGCCATGGATGTAGGCATCGAGGAGGAGGGCGATGAAGTCG
TTGATCAAGTCTTGGAAGAAATTGGCGTTGACCTCAACCAAGCTGTAAGCATCCTTTCCCAACCGCAGCTCTTCA
GACCAAGATACTGACTTTTCTCTGTCTGACAGCTTGGCGAAACCCCCACAGTCCTGGGAAGCTCGGCGGTACCCG
AGGGCCGAATTGCACAAGCGATAGGAGGCGGCGGCGGCGGCGGCGGCGGTGGTGATCCTGTTGACGACGACCTCC
AGGCACGTCTGGACAGCTTAAGAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail