Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1090
Gene name
LocationContig_125:48682..51212
Strand-
Gene length (bp)2530
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.2E-71 448 722
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.4E-35 227 437
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 4.2E-35 28 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 11 739 9.0E-152
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 19 744 8.0E-116
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 746 2.0E-29
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 75 737 6.0E-28
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 75 741 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 11 739 9.0E-152
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 19 744 8.0E-116
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 746 2.0E-29
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 75 737 6.0E-28
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 75 741 4.0E-27
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 28 745 4.0E-25
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 341 729 1.0E-24
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 75 753 1.0E-24
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 75 737 4.0E-24
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 327 740 3.0E-23
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 74 753 4.0E-23
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 359 747 1.0E-21
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 29 725 1.0E-21
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 313 729 9.0E-21
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 348 740 1.0E-20
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 77 747 5.0E-20
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 337 747 2.0E-19
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 30 722 2.0E-18
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 428 758 1.0E-13
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 182 745 8.0E-13
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 78 687 2.0E-12
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 78 687 1.0E-11
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 392 722 2.0E-09
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 428 722 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 107 126 19
3 184 206 22
4 452 474 22
5 498 520 22
6 540 562 22
7 596 618 22
8 639 661 22
9 666 688 22
10 709 731 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1090
MDRIFGDDDCNYEDYVRPPSKNQKDLEVQLVLSLILGGSALVAFCILRPRWPSLYAARKRRLGSEVSLPNLPDSF
LGWIPKLHGVSEEQVLVWAGLDAFVFLTFFKMAIRLFAFMAFFAMVVLWPINSHYRHFSVVLGGDGPQSGNGSRT
NPQWYYSKQQALDGHGVAIGILKDGDKDKSGERSYLWAYVVFTYFFVLLTIYSINWETVRIIKFRQEYLGSQSTV
TDRTFRLTGIPRGLRSEQRVKKLIEGLDIGLVERVTLCRNWKELDELVEQREGVLRKLEAVWAGFLRKQRWSGKL
PVANAGRQRHGSRARQEGSGASEGASEGESTQLLGGEANRRQEAVEEERPEIKIGYGPLKLGSRKVDAIDYYQEQ
LRRLDSQVLQARKRKYQATDMALVTMDSVASCQMVIQARIDARPGRLLTKPTPSPSDLVWKNTYAPRGIRRLKSW
AITLFITVLTLLWIFPTAILASWLSICTIKRLLPSFASWLSQHPLLQTLFQNGAPTLVVSLLNVAVPYLYDWLSN
HQGMISHGDVELSVISKNFFFTFFNTFFVFAVSRTGFDFWSVLRGMLKDTSKIPAAIAADVEDLSIFYISFIMLQ
GIGLMPFRILELGSVLLLPMYRIASSTPRDFAELRRPPVFQYGFYLPTALLVFNLCLIYSVLMWGFAILLFGTVY
FALGYLTYKYMVLYAMDQPQHATGGAWRIICYRIMIGLLVFEVVMVGQIASLAAFVQSVTVLPLIPFTVWYTGTK
AGRGAGGRGGGA*
Coding >OphauB2|1090
ATGGATCGAATATTTGGCGACGACGACTGCAACTACGAGGACTATGTGCGGCCGCCGTCCAAGAACCAAAAGGAT
CTCGAGGTGCAGCTTGTGCTGTCGCTGATTTTGGGGGGAAGTGCTCTGGTGGCGTTTTGCATTTTACGCCCCAGA
TGGCCTTCGCTGTACGCTGCCCGCAAGCGGCGTCTGGGCAGCGAGGTGAGCCTGCCGAATCTTCCCGACTCGTTT
TTGGGCTGGATACCCAAGCTGCATGGCGTTAGCGAGGAGCAGGTGTTGGTGTGGGCTGGGCTGGATGCCTTTGTG
TTTTTGACATTTTTCAAAATGGCGATTCGTCTCTTTGCCTTTATGGCCTTTTTCGCCATGGTGGTGCTATGGCCC
ATCAATAGCCACTACCGCCACTTTTCCGTGGTGCTGGGCGGCGATGGCCCGCAAAGTGGAAACGGCTCGCGAACA
AACCCCCAGTGGTACTATTCGAAGCAGCAAGCACTGGATGGGCATGGGGTGGCGATTGGCATTCTCAAGGACGGA
GACAAGGACAAGAGCGGGGAGCGCAGCTATCTCTGGGCCTATGTCGTCTTTACCTACTTTTTTGTCTTGTTGACC
ATTTACTCCATCAACTGGGAGACGGTTCGCATCATCAAGTTTCGGCAAGAGTACCTCGGCTCGCAGTCTACAGTG
ACGGACCGGACCTTTCGGCTGACGGGGATTCCGCGAGGGCTGCGCTCGGAGCAAAGGGTCAAGAAGCTCATTGAA
GGGCTGGATATTGGGCTCGTGGAGAGGGTGACGCTGTGTCGGAATTGGAAAGAGCTGGACGAGTTGGTTGAGCAG
CGCGAGGGGGTGTTGCGCAAGCTCGAGGCTGTATGGGCGGGCTTTCTTCGCAAGCAGCGTTGGTCGGGCAAGCTG
CCCGTGGCCAATGCCGGGCGGCAGCGGCATGGAAGCAGAGCTAGGCAAGAGGGCAGTGGCGCGTCGGAGGGCGCG
TCGGAGGGCGAGTCGACGCAGCTCTTGGGCGGCGAGGCCAACAGACGACAAGAGGCTGTGGAGGAGGAGCGGCCC
GAAATCAAGATTGGCTACGGGCCACTCAAGCTCGGCTCGCGCAAGGTTGATGCCATTGACTACTACCAGGAGCAG
CTGCGCAGGCTCGACAGCCAGGTGCTGCAGGCACGCAAGCGCAAGTACCAGGCTACCGACATGGCGCTGGTGACG
ATGGACTCGGTGGCGTCGTGCCAGATGGTGATTCAGGCCAGGATAGATGCTCGGCCCGGCAGGCTGCTGACCAAG
CCGACGCCGTCGCCGTCGGACCTGGTGTGGAAGAATACATATGCGCCGCGCGGCATACGGCGCCTCAAGTCGTGG
GCCATAACCCTCTTCATCACGGTGCTGACGCTGCTCTGGATCTTCCCCACGGCAATACTGGCGTCGTGGCTCAGC
ATCTGCACCATTAAGCGCCTGCTGCCGTCGTTTGCCAGCTGGCTGTCGCAGCACCCGCTGCTGCAGACGCTCTTC
CAAAACGGAGCGCCCACGCTCGTGGTGTCGCTGCTCAACGTGGCGGTGCCCTATCTCTACGACTGGCTCTCCAAC
CACCAGGGCATGATTTCCCACGGCGACGTGGAGCTGTCCGTCATATCCAAAAACTTCTTCTTTACCTTTTTCAAC
ACCTTTTTTGTCTTTGCCGTGTCGCGCACCGGCTTTGACTTTTGGAGCGTGCTGCGCGGCATGCTCAAGGACACG
AGCAAGATACCCGCTGCCATTGCCGCCGACGTGGAGGACCTGTCCATCTTTTACATTAGCTTCATCATGCTGCAG
GGCATTGGCCTCATGCCCTTTCGCATCCTCGAGCTGGGCAGCGTGCTGCTGCTGCCCATGTACCGCATCGCTTCC
TCGACGCCCCGCGACTTTGCCGAGCTGCGCCGCCCGCCCGTCTTTCAGTACGGCTTCTACCTGCCCACGGCGCTG
CTCGTCTTCAACCTGTGCCTCATTTACAGCGTGCTCATGTGGGGCTTTGCCATTTTACTCTTTGGCACCGTCTAC
TTTGCCCTGGGCTACCTGACGTACAAGTACATGGTGCTGTATGCCATGGACCAGCCCCAGCATGCAACGGGCGGA
GCCTGGCGCATTATTTGCTACCGCATCATGATTGGGCTGCTGGTCTTTGAAGTGGTCATGGTGGGGCAGATTGCG
TCGCTGGCCGCCTTTGTGCAGTCGGTCACGGTGCTGCCGCTGATTCCCTTTACCGTGTGGTATACCGGGACCAAG
GCTGGGCGAGGCGCCGGGGGACGAGGTGGCGGTGCTTGA
Transcript >OphauB2|1090
ATGGATCGAATATTTGGCGACGACGACTGCAACTACGAGGACTATGTGCGGCCGCCGTCCAAGAACCAAAAGGAT
CTCGAGGTGCAGCTTGTGCTGTCGCTGATTTTGGGGGGAAGTGCTCTGGTGGCGTTTTGCATTTTACGCCCCAGA
TGGCCTTCGCTGTACGCTGCCCGCAAGCGGCGTCTGGGCAGCGAGGTGAGCCTGCCGAATCTTCCCGACTCGTTT
TTGGGCTGGATACCCAAGCTGCATGGCGTTAGCGAGGAGCAGGTGTTGGTGTGGGCTGGGCTGGATGCCTTTGTG
TTTTTGACATTTTTCAAAATGGCGATTCGTCTCTTTGCCTTTATGGCCTTTTTCGCCATGGTGGTGCTATGGCCC
ATCAATAGCCACTACCGCCACTTTTCCGTGGTGCTGGGCGGCGATGGCCCGCAAAGTGGAAACGGCTCGCGAACA
AACCCCCAGTGGTACTATTCGAAGCAGCAAGCACTGGATGGGCATGGGGTGGCGATTGGCATTCTCAAGGACGGA
GACAAGGACAAGAGCGGGGAGCGCAGCTATCTCTGGGCCTATGTCGTCTTTACCTACTTTTTTGTCTTGTTGACC
ATTTACTCCATCAACTGGGAGACGGTTCGCATCATCAAGTTTCGGCAAGAGTACCTCGGCTCGCAGTCTACAGTG
ACGGACCGGACCTTTCGGCTGACGGGGATTCCGCGAGGGCTGCGCTCGGAGCAAAGGGTCAAGAAGCTCATTGAA
GGGCTGGATATTGGGCTCGTGGAGAGGGTGACGCTGTGTCGGAATTGGAAAGAGCTGGACGAGTTGGTTGAGCAG
CGCGAGGGGGTGTTGCGCAAGCTCGAGGCTGTATGGGCGGGCTTTCTTCGCAAGCAGCGTTGGTCGGGCAAGCTG
CCCGTGGCCAATGCCGGGCGGCAGCGGCATGGAAGCAGAGCTAGGCAAGAGGGCAGTGGCGCGTCGGAGGGCGCG
TCGGAGGGCGAGTCGACGCAGCTCTTGGGCGGCGAGGCCAACAGACGACAAGAGGCTGTGGAGGAGGAGCGGCCC
GAAATCAAGATTGGCTACGGGCCACTCAAGCTCGGCTCGCGCAAGGTTGATGCCATTGACTACTACCAGGAGCAG
CTGCGCAGGCTCGACAGCCAGGTGCTGCAGGCACGCAAGCGCAAGTACCAGGCTACCGACATGGCGCTGGTGACG
ATGGACTCGGTGGCGTCGTGCCAGATGGTGATTCAGGCCAGGATAGATGCTCGGCCCGGCAGGCTGCTGACCAAG
CCGACGCCGTCGCCGTCGGACCTGGTGTGGAAGAATACATATGCGCCGCGCGGCATACGGCGCCTCAAGTCGTGG
GCCATAACCCTCTTCATCACGGTGCTGACGCTGCTCTGGATCTTCCCCACGGCAATACTGGCGTCGTGGCTCAGC
ATCTGCACCATTAAGCGCCTGCTGCCGTCGTTTGCCAGCTGGCTGTCGCAGCACCCGCTGCTGCAGACGCTCTTC
CAAAACGGAGCGCCCACGCTCGTGGTGTCGCTGCTCAACGTGGCGGTGCCCTATCTCTACGACTGGCTCTCCAAC
CACCAGGGCATGATTTCCCACGGCGACGTGGAGCTGTCCGTCATATCCAAAAACTTCTTCTTTACCTTTTTCAAC
ACCTTTTTTGTCTTTGCCGTGTCGCGCACCGGCTTTGACTTTTGGAGCGTGCTGCGCGGCATGCTCAAGGACACG
AGCAAGATACCCGCTGCCATTGCCGCCGACGTGGAGGACCTGTCCATCTTTTACATTAGCTTCATCATGCTGCAG
GGCATTGGCCTCATGCCCTTTCGCATCCTCGAGCTGGGCAGCGTGCTGCTGCTGCCCATGTACCGCATCGCTTCC
TCGACGCCCCGCGACTTTGCCGAGCTGCGCCGCCCGCCCGTCTTTCAGTACGGCTTCTACCTGCCCACGGCGCTG
CTCGTCTTCAACCTGTGCCTCATTTACAGCGTGCTCATGTGGGGCTTTGCCATTTTACTCTTTGGCACCGTCTAC
TTTGCCCTGGGCTACCTGACGTACAAGTACATGGTGCTGTATGCCATGGACCAGCCCCAGCATGCAACGGGCGGA
GCCTGGCGCATTATTTGCTACCGCATCATGATTGGGCTGCTGGTCTTTGAAGTGGTCATGGTGGGGCAGATTGCG
TCGCTGGCCGCCTTTGTGCAGTCGGTCACGGTGCTGCCGCTGATTCCCTTTACCGTGTGGTATACCGGGACCAAG
GCTGGGCGAGGCGCCGGGGGACGAGGTGGCGGTGCTTGA
Gene >OphauB2|1090
ATGGATCGAATATTTGGCGACGACGACTGCAACTACGAGGACTATGTGCGGCCGCCGTCCAAGAACCAAAAGGAT
CTCGAGGTGCAGCTTGTGCTGTCGCTGATTTTGGGGGGAAGTGCTCTGGTGGCGTTTTGCGTGAGTTGAACGGCC
TGGTTTTATGCAAGAGACAAAGCTGGACTCGAGTTTGCGTGGCTGGAAGCATGGGCTTGGGTGCTGGCAAAGAGG
CGGCTAATAGACATGTAGATTTTACGCCCCAGATGGCCTTCGCTGTACGCTGCCCGCAAGCGGCGTCTGGGCAGC
GAGGTGAGCCTGCCGAATCTTCCCGACTCGTTTTTGGGCTGGATACCCAAGCTGCATGGCGTTAGCGAGGAGCAG
GTGTTGGTGTGGGCTGGGCTGGATGCCTTTGTGGTTAGTTTTGACCTGGGCACCAAGATGGAGAGAGACAGAGAG
CATGGCGAGGCTAACACGGGCGCATACAGTTTTTGACATTTTTCAAAATGGCGATTCGTCTCTTTGCCTTTATGG
CCTTTTTCGCCATGGTGGTGCTATGGCCCATCAATAGCCACTACCGCCACTTTTCCGTGGTGCTGGGCGGCGATG
GCCCGCAAAGTGGAAACGGCTCGCGAACAAACCCCCAGTGGTACTATTCGAAGCAGCAAGCACTGGATGGGCATG
GGGTGGCGATTGGCATTCTCAAGGACGGAGACAAGGACAAGAGCGGGGAGCGCAGCTATCTCTGGGCCTATGTCG
TCTTTACCTACTTTTTTGTCTTGTTGACCATTTACTCCATCAACTGGGAGACGGTTCGCATCATCAAGTTTCGGC
AAGAGTACCTCGGCTCGCAGTCTACAGTGACGGACCGGACCTTTCGGCTGACGGGGATTCCGCGAGGGCTGCGCT
CGGAGCAAAGGGTCAAGAAGCTCATTGAAGGGCTGGATATTGGGCTCGTGGAGAGGGTGACGCTGTGTCGGAATT
GGAAAGAGCTGGACGAGTTGGTTGAGCAGCGCGAGGGGGTGTTGCGCAAGCTCGAGGCTGTATGGGCGGGCTTTC
TTCGCAAGCAGCGTTGGTCGGGCAAGCTGCCCGTGGCCAATGCCGGGCGGCAGCGGCATGGAAGCAGAGCTAGGC
AAGAGGGCAGTGGCGCGTCGGAGGGCGCGTCGGAGGGCGAGTCGACGCAGCTCTTGGGCGGCGAGGCCAACAGAC
GACAAGAGGCTGTGGAGGAGGAGCGGCCCGAAATCAAGATTGGCTACGGGCCACTCAAGCTCGGCTCGCGCAAGG
TTGATGCCATTGACTACTACCAGGAGCAGCTGCGCAGGCTCGACAGCCAGGTGCTGCAGGCACGCAAGCGCAAGT
ACCAGGCTACCGACATGGCGCTGGTGACGATGGACTCGGTGGCGTCGTGCCAGATGGTGATTCAGGCCAGGATAG
ATGCTCGGCCCGGCAGGCTGCTGACCAAGCCGACGCCGTCGCCGTCGGACCTGGTGTGGAAGAATACATATGCGC
CGCGCGGCATACGGCGCCTCAAGTCGTGGGCCATAACCCTCTTCATCACGGTGCTGACGCTGCTCTGGATCTTCC
CCACGGCAATACTGGCGTCGTGGCTCAGCATCTGCACCATTAAGCGCCTGCTGCCGTCGTTTGCCAGCTGGCTGT
CGCAGCACCCGCTGCTGCAGACGCTCTTCCAAAACGGAGCGCCCACGCTCGTGGTGTCGCTGCTCAACGTGGCGG
TGCCCTATCTCTACGACTGGCTCTCCAACCACCAGGGCATGATTTCCCACGGCGACGTGGAGCTGTCCGTCATAT
CCAAAAACTTCTTCTTTACCTTTTTCAACACCTTTTTTGTCTTTGCCGTGTCGCGCACCGGCTTTGACTTTTGGA
GCGTGCTGCGCGGCATGCTCAAGGACACGAGCAAGATACCCGCTGCCATTGCCGCCGACGTGGAGGACCTGTCCA
TCTTTTACATTAGCTTCATCATGCTGCAGGGCATTGGCCTCATGCCCTTTCGCATCCTCGAGCTGGGCAGCGTGC
TGCTGCTGCCCATGTACCGCATCGCTTCCTCGACGCCCCGCGACTTTGCCGAGCTGCGCCGCCCGCCCGTCTTTC
AGTACGGCTTCTACCTGCCCACGGCGCTGCTCGTCTTCAACCTGTGCCTCATTTACAGCGTGCTCATGTGGGGCT
TTGCCATTTTACTCTTTGGCACCGTCTACTTTGCCCTGGGCTACCTGACGTACAAGTACATGGTGCTGTATGCCA
TGGACCAGCCCCAGCATGCAACGGGCGGAGCCTGGCGCATTATTTGCTACCGCATCATGATTGGGCTGCTGGTCT
TTGAAGTGGTCATGGTGGGGCAGATTGCGTCGCTGGCCGCCTTTGTGCAGTCGGTCACGGTGCTGCCGCTGATTC
CCTTTACCGTGTGGTATAGTTATTACTTTAAGCGGCGCTATGAGCCCTTGACGCGCATTATAGCGCTGAGGGCCA
TTAAGCCGGGACCAAGGCTGGGCGAGGCGCCGGGGGACGAGGTGGCGGTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail