Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1086
Gene name
LocationContig_125:39057..41583
Strand+
Gene length (bp)2526
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19834 DUF6314 Family of unknown function (DUF6314) 1.7E-29 626 789
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.1E-10 3 204
PF13454 NAD_binding_9 FAD-NAD(P)-binding 5.9E-10 7 146
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.8E-08 7 57
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 2.2E-07 106 217
PF00743 FMO-like Flavin-binding monooxygenase-like 2.8E-07 2 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 28 200 1.0E-13
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 4 204 1.0E-07
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 4 204 1.0E-07
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 4 204 1.0E-07
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 1 200 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 28 200 1.0E-13
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 4 204 1.0E-07
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 4 204 1.0E-07
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 4 204 1.0E-07
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 1 200 3.0E-07
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 1 213 8.0E-07
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 1 213 1.0E-06
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 1 213 2.0E-06
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 1 213 2.0E-06
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 1 213 2.0E-06
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 5 160 3.0E-06
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 1 146 3.0E-06
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 5 160 3.0E-06
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 1 213 4.0E-06
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 1 205 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1643
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3543
Ophiocordyceps australis map64 (Brazil) OphauB2|1086 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03619
Ophiocordyceps camponoti-rufipedis Ophun1|6143
Ophiocordyceps kimflemingae Ophio5|17
Ophiocordyceps subramaniannii Hirsu2|1335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1086
MAKSVCIVGAGPSGVVAAKTLVHNAGGGFRVSLFEAQNSVGGLWPSRDDKSQGRLIDGLMVCNQSQHTMHFSDMA
WEAETGQMPRAWQVGRYIEGYVERYLDGQPAFTLRLSTRVVKAEEREGGWEIETSKGERERFEYLVVASGYFGEA
RMADEVKGASVPVVHSSAYTGLHQLLQGSELGPEAKILVVGGQLSGVEAAAAVARDISTARHGERESGVKNVETL
SVEHIVQHPVWIFPLYTCPKPEEAAPSFLPLDCCSYNLANRSVPLENTQGHVSVGAARRMHALFEAVVGTDQSEF
GLRIGEEERDEVPYLAMSDVYADFVRSGLISVVKGRLAWVRADKTASVDAATKCLHSAEQAPRPKTATAVLASGR
QIANVAAMISATGFDAASSLDFLPASVLDKLGLAPEHGGQVLALGMHATLHANVARLGFVGFYRSPYWGVMQMQA
RLLAALWSLGQEDKRGKQVEQAVKRGEKKQETEETREDKMATSHGHAEVSKAQKERMEKEEGEQDEGKRAQNQLC
RALAADDSIARTLALRNDARLSQFPMGDYPWLMQEFSSALCIPLVPMPAPLNSLCPARYPCPHDDAQAQAQAAAS
RASLAQTISSALSSPRFVPRAVFRSLLGKWNLQRSVTSRSPSHPSGLFSGTATFSLRDTSPLESSLGFEYVYRED
GTFCASDLRLEFRASRSYVWRYHEASNVVSVWFVRTDGHGARAVTDYLFHELEFGPRAGDGRAWSAVAAHLCLDD
WYNMAYEFVFCAVNLRSWSVQYTVSGPKKDYSIKGTYTR*
Coding >OphauB2|1086
ATGGCCAAATCTGTTTGCATTGTGGGGGCGGGACCGTCGGGCGTCGTGGCGGCCAAGACGCTTGTGCACAATGCG
GGCGGAGGATTTCGCGTCAGTCTGTTTGAGGCACAGAACAGCGTGGGCGGTCTATGGCCCAGCAGAGACGACAAG
AGCCAAGGTCGCCTGATTGACGGGCTCATGGTATGTAACCAGAGCCAGCACACGATGCATTTTAGCGACATGGCG
TGGGAAGCCGAGACGGGGCAGATGCCGAGGGCCTGGCAGGTGGGACGGTATATTGAAGGCTATGTGGAGCGGTAT
CTCGACGGACAGCCGGCATTCACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGAGGAGAGGGAAGGCGGGTGG
GAGATTGAGACGTCCAAGGGGGAGAGAGAGAGGTTTGAGTATTTAGTCGTTGCGTCGGGATATTTTGGAGAGGCG
CGCATGGCGGACGAGGTCAAGGGGGCTTCAGTGCCGGTAGTGCATAGCAGTGCGTACACGGGGCTGCATCAGCTG
CTCCAGGGAAGCGAGCTGGGGCCAGAGGCAAAGATCTTGGTGGTGGGAGGGCAGTTGTCGGGCGTGGAGGCTGCC
GCGGCGGTGGCCAGAGATATATCGACGGCGAGGCATGGAGAGAGGGAGAGCGGGGTCAAGAATGTCGAGACACTG
AGCGTTGAGCACATTGTGCAACACCCAGTGTGGATATTTCCGCTCTATACATGTCCCAAGCCTGAAGAAGCGGCG
CCGTCCTTCTTACCGCTGGATTGCTGTTCGTACAACCTGGCGAATAGAAGTGTCCCGCTAGAGAATACGCAGGGA
CATGTAAGTGTTGGAGCAGCGCGGAGAATGCATGCCTTGTTCGAGGCAGTCGTGGGGACTGACCAGAGCGAGTTT
GGCCTGCGGATTGGGGAGGAGGAGAGGGACGAGGTGCCCTACTTGGCCATGAGTGATGTGTATGCCGACTTTGTG
CGCAGCGGTTTGATTTCAGTGGTCAAGGGGAGGCTTGCTTGGGTGCGGGCGGACAAGACGGCCTCAGTGGACGCT
GCGACGAAATGTTTGCACAGCGCCGAGCAAGCTCCTCGGCCCAAGACGGCCACGGCAGTCCTAGCAAGCGGCAGG
CAAATCGCCAATGTGGCAGCCATGATATCAGCCACGGGCTTCGACGCGGCGTCCAGCCTTGACTTCTTGCCAGCG
TCGGTATTGGATAAGCTTGGCTTGGCGCCCGAGCACGGGGGACAGGTGCTGGCGCTGGGAATGCACGCAACGCTG
CATGCCAATGTGGCGCGGCTGGGGTTTGTTGGATTTTACCGGTCGCCGTACTGGGGGGTTATGCAGATGCAGGCG
AGGCTGTTGGCTGCGCTGTGGAGCTTGGGGCAGGAGGACAAGAGGGGGAAGCAAGTCGAGCAAGCGGTCAAGAGG
GGAGAGAAGAAACAAGAGACGGAAGAGACCAGGGAGGACAAGATGGCGACAAGCCATGGCCATGCAGAGGTTTCC
AAGGCCCAAAAGGAGAGAATGGAGAAGGAGGAGGGCGAGCAAGACGAGGGCAAAAGGGCCCAAAATCAACTGTGC
CGAGCCCTGGCGGCCGACGACTCCATTGCCCGCACCCTCGCCCTACGCAACGACGCTCGCCTCTCCCAGTTCCCC
ATGGGCGACTACCCCTGGCTGATGCAAGAATTCTCGTCGGCTCTCTGCATCCCGCTTGTCCCCATGCCGGCGCCT
CTCAACTCCCTCTGCCCAGCACGCTACCCTTGCCCCCACGACGACGCCCAAGCCCAAGCCCAAGCCGCCGCCTCT
CGAGCCAGCCTCGCACAAACAATCTCTTCTGCCTTGTCGTCCCCGCGCTTCGTCCCCCGCGCCGTATTTCGCAGC
CTGCTGGGGAAATGGAATCTTCAACGCAGCGTCACGTCTCGCTCACCATCTCACCCCAGTGGTCTATTCTCCGGC
ACGGCAACCTTTTCCCTGCGCGACACGTCGCCTCTGGAATCGAGCTTGGGCTTTGAGTATGTCTACCGTGAGGAC
GGCACCTTTTGCGCCTCAGACTTGCGGCTCGAGTTTCGGGCGTCGAGGAGCTATGTCTGGCGCTATCATGAGGCG
AGCAATGTCGTGTCGGTGTGGTTTGTGCGTACCGATGGTCATGGGGCCAGGGCGGTGACGGACTACTTGTTTCAT
GAGCTCGAGTTTGGCCCTCGGGCGGGCGACGGCAGGGCATGGAGTGCCGTGGCGGCCCATCTCTGCCTGGACGAC
TGGTACAACATGGCGTACGAGTTTGTCTTTTGTGCTGTCAATTTGCGAAGCTGGAGCGTGCAGTATACCGTCAGC
GGGCCCAAAAAGGACTATAGCATCAAGGGCACGTATACGCGCTAG
Transcript >OphauB2|1086
ATGGCCAAATCTGTTTGCATTGTGGGGGCGGGACCGTCGGGCGTCGTGGCGGCCAAGACGCTTGTGCACAATGCG
GGCGGAGGATTTCGCGTCAGTCTGTTTGAGGCACAGAACAGCGTGGGCGGTCTATGGCCCAGCAGAGACGACAAG
AGCCAAGGTCGCCTGATTGACGGGCTCATGGTATGTAACCAGAGCCAGCACACGATGCATTTTAGCGACATGGCG
TGGGAAGCCGAGACGGGGCAGATGCCGAGGGCCTGGCAGGTGGGACGGTATATTGAAGGCTATGTGGAGCGGTAT
CTCGACGGACAGCCGGCATTCACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGAGGAGAGGGAAGGCGGGTGG
GAGATTGAGACGTCCAAGGGGGAGAGAGAGAGGTTTGAGTATTTAGTCGTTGCGTCGGGATATTTTGGAGAGGCG
CGCATGGCGGACGAGGTCAAGGGGGCTTCAGTGCCGGTAGTGCATAGCAGTGCGTACACGGGGCTGCATCAGCTG
CTCCAGGGAAGCGAGCTGGGGCCAGAGGCAAAGATCTTGGTGGTGGGAGGGCAGTTGTCGGGCGTGGAGGCTGCC
GCGGCGGTGGCCAGAGATATATCGACGGCGAGGCATGGAGAGAGGGAGAGCGGGGTCAAGAATGTCGAGACACTG
AGCGTTGAGCACATTGTGCAACACCCAGTGTGGATATTTCCGCTCTATACATGTCCCAAGCCTGAAGAAGCGGCG
CCGTCCTTCTTACCGCTGGATTGCTGTTCGTACAACCTGGCGAATAGAAGTGTCCCGCTAGAGAATACGCAGGGA
CATGTAAGTGTTGGAGCAGCGCGGAGAATGCATGCCTTGTTCGAGGCAGTCGTGGGGACTGACCAGAGCGAGTTT
GGCCTGCGGATTGGGGAGGAGGAGAGGGACGAGGTGCCCTACTTGGCCATGAGTGATGTGTATGCCGACTTTGTG
CGCAGCGGTTTGATTTCAGTGGTCAAGGGGAGGCTTGCTTGGGTGCGGGCGGACAAGACGGCCTCAGTGGACGCT
GCGACGAAATGTTTGCACAGCGCCGAGCAAGCTCCTCGGCCCAAGACGGCCACGGCAGTCCTAGCAAGCGGCAGG
CAAATCGCCAATGTGGCAGCCATGATATCAGCCACGGGCTTCGACGCGGCGTCCAGCCTTGACTTCTTGCCAGCG
TCGGTATTGGATAAGCTTGGCTTGGCGCCCGAGCACGGGGGACAGGTGCTGGCGCTGGGAATGCACGCAACGCTG
CATGCCAATGTGGCGCGGCTGGGGTTTGTTGGATTTTACCGGTCGCCGTACTGGGGGGTTATGCAGATGCAGGCG
AGGCTGTTGGCTGCGCTGTGGAGCTTGGGGCAGGAGGACAAGAGGGGGAAGCAAGTCGAGCAAGCGGTCAAGAGG
GGAGAGAAGAAACAAGAGACGGAAGAGACCAGGGAGGACAAGATGGCGACAAGCCATGGCCATGCAGAGGTTTCC
AAGGCCCAAAAGGAGAGAATGGAGAAGGAGGAGGGCGAGCAAGACGAGGGCAAAAGGGCCCAAAATCAACTGTGC
CGAGCCCTGGCGGCCGACGACTCCATTGCCCGCACCCTCGCCCTACGCAACGACGCTCGCCTCTCCCAGTTCCCC
ATGGGCGACTACCCCTGGCTGATGCAAGAATTCTCGTCGGCTCTCTGCATCCCGCTTGTCCCCATGCCGGCGCCT
CTCAACTCCCTCTGCCCAGCACGCTACCCTTGCCCCCACGACGACGCCCAAGCCCAAGCCCAAGCCGCCGCCTCT
CGAGCCAGCCTCGCACAAACAATCTCTTCTGCCTTGTCGTCCCCGCGCTTCGTCCCCCGCGCCGTATTTCGCAGC
CTGCTGGGGAAATGGAATCTTCAACGCAGCGTCACGTCTCGCTCACCATCTCACCCCAGTGGTCTATTCTCCGGC
ACGGCAACCTTTTCCCTGCGCGACACGTCGCCTCTGGAATCGAGCTTGGGCTTTGAGTATGTCTACCGTGAGGAC
GGCACCTTTTGCGCCTCAGACTTGCGGCTCGAGTTTCGGGCGTCGAGGAGCTATGTCTGGCGCTATCATGAGGCG
AGCAATGTCGTGTCGGTGTGGTTTGTGCGTACCGATGGTCATGGGGCCAGGGCGGTGACGGACTACTTGTTTCAT
GAGCTCGAGTTTGGCCCTCGGGCGGGCGACGGCAGGGCATGGAGTGCCGTGGCGGCCCATCTCTGCCTGGACGAC
TGGTACAACATGGCGTACGAGTTTGTCTTTTGTGCTGTCAATTTGCGAAGCTGGAGCGTGCAGTATACCGTCAGC
GGGCCCAAAAAGGACTATAGCATCAAGGGCACGTATACGCGCTAG
Gene >OphauB2|1086
ATGGCCAAATCTGTTTGCATTGTGGGCACGTCGACCCCACTCCCCTCTTGCCGGGAGGATGCTTGGCAAAGGGAG
AGAATTGACTGACGATATGCTTTTCTCCGGCACAGGGGCGGGACCGTCGGGCGTCGTGGCGGCCAAGACGCTTGT
GCACAATGCGGGCGGAGGATTTCGCGTCAGTCTGTTTGAGGCACAGAACAGCGTGGGCGGTCTATGGCCCAGCAG
AGACGACAAGAGCCAAGGTCGCCTGATTGACGGGCTCATGGTATGTAACCAGAGCCAGCACACGATGCATTTTAG
CGACATGGCGTGGGAAGCCGAGACGGGGCAGATGCCGAGGGCCTGGCAGGTGGGACGGTATATTGAAGGCTATGT
GGAGCGGTATCTCGACGGACAGCCGGCATTCACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGAGGAGAGGGA
AGGCGGGTGGGAGATTGAGACGTCCAAGGGGGAGAGAGAGAGGTTTGAGTATTTAGTCGTTGCGTCGGGATATTT
TGGAGAGGCGCGCATGGCGGACGAGGTCAAGGGGGCTTCAGTGCCGGTAGTGCATAGCAGTGCGTACACGGGGCT
GCATCAGCTGCTCCAGGGAAGCGAGCTGGGGCCAGAGGCAAAGATCTTGGTGGTGGGAGGGCAGTTGTCGGGCGT
GGAGGCTGCCGCGGCGGTGGCCAGAGATATATCGACGGCGAGGCATGGAGAGAGGGAGAGCGGGGTCAAGAATGT
CGAGACACTGAGCGTTGAGCACATTGTGCAACACCCAGTGTGGATATTTCCGCTCTATACATGTCCCAAGGTGAG
TATTCAAACAAGAAGCAAGGAGTCAAGACTAACCTCGCTCTTTCTTGTCAATCCTTGGTGCTATAGCCTGAAGAA
GCGGCGCCGTCCTTCTTACCGCTGGATTGCTGTTCGTACAACCTGGCGAATAGAAGTGTCCCGCTAGAGAATACG
CAGGGACATGTAAGTGTTGGAGCAGCGCGGAGAATGCATGCCTTGTTCGAGGCAGTCGTGGGGACTGACCAGAGC
GAGTTTGGCCTGCGGATTGGGGAGGAGGAGAGGGACGAGGTGCCCTACTTGGCCATGAGTGATGTGTATGCCGAC
TTTGTGCGCAGCGGTTTGATTTCAGTGGTCAAGGGGAGGCTTGCTTGGGTGCGGGCGGACAAGACGGCCTCAGTG
GACGCTGCGACGAAATGTTTGCACAGCGCCGAGCAAGCTCCTCGGCCCAAGACGGCCACGGCAGTCCTAGCAAGC
GGCAGGCAAATCGCCAATGTGGCAGCCATGATATCAGCCACGGGCTTCGACGCGGCGTCCAGCCTTGACTTCTTG
CCAGCGTCGGTATTGGATAAGCTTGGCTTGGCGCCCGAGCACGGGGGACAGGTGCTGGCGCTGGGAATGCACGCA
ACGCTGCATGCCAATGTGGCGCGGCTGGGGTTTGTTGGATTTTACCGGTCGCCGTACTGGGGGGTTATGCAGATG
CAGGCGAGGCTGTTGGCTGCGCTGTGGAGCTTGGGGCAGGAGGACAAGAGGGGGAAGCAAGTCGAGCAAGCGGTC
AAGAGGGGAGAGAAGAAACAAGAGACGGAAGAGACCAGGGAGGACAAGATGGCGACAAGCCATGGCCATGCAGAG
GTTTCCAAGGCCCAAAAGGAGAGAATGGAGAAGGAGGAGGGCGAGCAAGACGAGGGCAAAAGGGCCCAAAATCAA
CTGTGCCGAGCCCTGGCGGCCGACGACTCCATTGCCCGCACCCTCGCCCTACGCAACGACGCTCGCCTCTCCCAG
TTCCCCATGGGCGACTACCCCTGGCTGATGCAAGAATTCTCGTCGGCTCTCTGCATCCCGCTTGTCCCCATGCCG
GCGCCTCTCAACTCCCTCTGCCCAGCACGCTACCCTTGCCCCCACGACGACGCCCAAGCCCAAGCCCAAGCCGCC
GCCTCTCGAGCCAGCCTCGCACAAACAATCTCTTCTGCCTTGTCGTCCCCGCGCTTCGTCCCCCGCGCCGTATTT
CGCAGCCTGCTGGGGAAATGGAATCTTCAACGCAGCGTCACGTCTCGCTCACCATCTCACCCCAGTGGTCTATTC
TCCGGCACGGCAACCTTTTCCCTGCGCGACACGTCGCCTCTGGAATCGAGCTTGGGCTTTGAGTATGTCTACCGT
GAGGACGGCACCTTTTGCGCCTCAGACTTGCGGCTCGAGTTTCGGGCGTCGAGGAGCTATGTCTGGCGCTATCAT
GAGGCGAGCAATGTCGTGTCGGTGTGGTTTGTGCGTACCGATGGTCATGGGGCCAGGGCGGTGACGGACTACTTG
TTTCATGAGCTCGAGTTTGGCCCTCGGGCGGGCGACGGCAGGGCATGGAGTGCCGTGGCGGCCCATCTCTGCCTG
GACGACTGGTACAACATGGCGTACGAGTTTGTCTTTTGTGCTGTCAATTTGCGAAGCTGGAGCGTGCAGTATACC
GTCAGCGGGCCCAAAAAGGACTATAGCATCAAGGGCACGTATACGCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail