Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1086
Gene name
LocationContig_125:39057..41583
Strand+
Gene length (bp)2526
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19834 DUF6314 Family of unknown function (DUF6314) 1.7E-29 626 789
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.1E-10 3 204
PF13454 NAD_binding_9 FAD-NAD(P)-binding 5.9E-10 7 146
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.8E-08 7 57
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 2.2E-07 106 217
PF00743 FMO-like Flavin-binding monooxygenase-like 2.8E-07 2 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 28 200 1.0E-13
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 4 204 1.0E-07
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 4 204 1.0E-07
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 4 204 1.0E-07
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 1 200 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38866|FMO1_YEAST Thiol-specific monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMO1 PE=1 SV=2 28 200 1.0E-13
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 4 204 1.0E-07
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 4 204 1.0E-07
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 4 204 1.0E-07
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 1 200 3.0E-07
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 1 213 8.0E-07
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 1 213 1.0E-06
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 1 213 2.0E-06
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 1 213 2.0E-06
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 1 213 2.0E-06
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 5 160 3.0E-06
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 1 146 3.0E-06
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 5 160 3.0E-06
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 1 213 4.0E-06
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 1 205 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1086
MAKSVCIVGAGPSGVVAAKTLVHNAGGGFRVSLFEAQNSVGGLWPSRDDKSQGRLIDGLMVCNQSQHTMHFSDMA
WEAETGQMPRAWQVGRYIEGYVERYLDGQPAFTLRLSTRVVKAEEREGGWEIETSKGERERFEYLVVASGYFGEA
RMADEVKGASVPVVHSSAYTGLHQLLQGSELGPEAKILVVGGQLSGVEAAAAVARDISTARHGERESGVKNVETL
SVEHIVQHPVWIFPLYTCPKPEEAAPSFLPLDCCSYNLANRSVPLENTQGHVSVGAARRMHALFEAVVGTDQSEF
GLRIGEEERDEVPYLAMSDVYADFVRSGLISVVKGRLAWVRADKTASVDAATKCLHSAEQAPRPKTATAVLASGR
QIANVAAMISATGFDAASSLDFLPASVLDKLGLAPEHGGQVLALGMHATLHANVARLGFVGFYRSPYWGVMQMQA
RLLAALWSLGQEDKRGKQVEQAVKRGEKKQETEETREDKMATSHGHAEVSKAQKERMEKEEGEQDEGKRAQNQLC
RALAADDSIARTLALRNDARLSQFPMGDYPWLMQEFSSALCIPLVPMPAPLNSLCPARYPCPHDDAQAQAQAAAS
RASLAQTISSALSSPRFVPRAVFRSLLGKWNLQRSVTSRSPSHPSGLFSGTATFSLRDTSPLESSLGFEYVYRED
GTFCASDLRLEFRASRSYVWRYHEASNVVSVWFVRTDGHGARAVTDYLFHELEFGPRAGDGRAWSAVAAHLCLDD
WYNMAYEFVFCAVNLRSWSVQYTVSGPKKDYSIKGTYTR*
Coding >OphauB2|1086
ATGGCCAAATCTGTTTGCATTGTGGGGGCGGGACCGTCGGGCGTCGTGGCGGCCAAGACGCTTGTGCACAATGCG
GGCGGAGGATTTCGCGTCAGTCTGTTTGAGGCACAGAACAGCGTGGGCGGTCTATGGCCCAGCAGAGACGACAAG
AGCCAAGGTCGCCTGATTGACGGGCTCATGGTATGTAACCAGAGCCAGCACACGATGCATTTTAGCGACATGGCG
TGGGAAGCCGAGACGGGGCAGATGCCGAGGGCCTGGCAGGTGGGACGGTATATTGAAGGCTATGTGGAGCGGTAT
CTCGACGGACAGCCGGCATTCACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGAGGAGAGGGAAGGCGGGTGG
GAGATTGAGACGTCCAAGGGGGAGAGAGAGAGGTTTGAGTATTTAGTCGTTGCGTCGGGATATTTTGGAGAGGCG
CGCATGGCGGACGAGGTCAAGGGGGCTTCAGTGCCGGTAGTGCATAGCAGTGCGTACACGGGGCTGCATCAGCTG
CTCCAGGGAAGCGAGCTGGGGCCAGAGGCAAAGATCTTGGTGGTGGGAGGGCAGTTGTCGGGCGTGGAGGCTGCC
GCGGCGGTGGCCAGAGATATATCGACGGCGAGGCATGGAGAGAGGGAGAGCGGGGTCAAGAATGTCGAGACACTG
AGCGTTGAGCACATTGTGCAACACCCAGTGTGGATATTTCCGCTCTATACATGTCCCAAGCCTGAAGAAGCGGCG
CCGTCCTTCTTACCGCTGGATTGCTGTTCGTACAACCTGGCGAATAGAAGTGTCCCGCTAGAGAATACGCAGGGA
CATGTAAGTGTTGGAGCAGCGCGGAGAATGCATGCCTTGTTCGAGGCAGTCGTGGGGACTGACCAGAGCGAGTTT
GGCCTGCGGATTGGGGAGGAGGAGAGGGACGAGGTGCCCTACTTGGCCATGAGTGATGTGTATGCCGACTTTGTG
CGCAGCGGTTTGATTTCAGTGGTCAAGGGGAGGCTTGCTTGGGTGCGGGCGGACAAGACGGCCTCAGTGGACGCT
GCGACGAAATGTTTGCACAGCGCCGAGCAAGCTCCTCGGCCCAAGACGGCCACGGCAGTCCTAGCAAGCGGCAGG
CAAATCGCCAATGTGGCAGCCATGATATCAGCCACGGGCTTCGACGCGGCGTCCAGCCTTGACTTCTTGCCAGCG
TCGGTATTGGATAAGCTTGGCTTGGCGCCCGAGCACGGGGGACAGGTGCTGGCGCTGGGAATGCACGCAACGCTG
CATGCCAATGTGGCGCGGCTGGGGTTTGTTGGATTTTACCGGTCGCCGTACTGGGGGGTTATGCAGATGCAGGCG
AGGCTGTTGGCTGCGCTGTGGAGCTTGGGGCAGGAGGACAAGAGGGGGAAGCAAGTCGAGCAAGCGGTCAAGAGG
GGAGAGAAGAAACAAGAGACGGAAGAGACCAGGGAGGACAAGATGGCGACAAGCCATGGCCATGCAGAGGTTTCC
AAGGCCCAAAAGGAGAGAATGGAGAAGGAGGAGGGCGAGCAAGACGAGGGCAAAAGGGCCCAAAATCAACTGTGC
CGAGCCCTGGCGGCCGACGACTCCATTGCCCGCACCCTCGCCCTACGCAACGACGCTCGCCTCTCCCAGTTCCCC
ATGGGCGACTACCCCTGGCTGATGCAAGAATTCTCGTCGGCTCTCTGCATCCCGCTTGTCCCCATGCCGGCGCCT
CTCAACTCCCTCTGCCCAGCACGCTACCCTTGCCCCCACGACGACGCCCAAGCCCAAGCCCAAGCCGCCGCCTCT
CGAGCCAGCCTCGCACAAACAATCTCTTCTGCCTTGTCGTCCCCGCGCTTCGTCCCCCGCGCCGTATTTCGCAGC
CTGCTGGGGAAATGGAATCTTCAACGCAGCGTCACGTCTCGCTCACCATCTCACCCCAGTGGTCTATTCTCCGGC
ACGGCAACCTTTTCCCTGCGCGACACGTCGCCTCTGGAATCGAGCTTGGGCTTTGAGTATGTCTACCGTGAGGAC
GGCACCTTTTGCGCCTCAGACTTGCGGCTCGAGTTTCGGGCGTCGAGGAGCTATGTCTGGCGCTATCATGAGGCG
AGCAATGTCGTGTCGGTGTGGTTTGTGCGTACCGATGGTCATGGGGCCAGGGCGGTGACGGACTACTTGTTTCAT
GAGCTCGAGTTTGGCCCTCGGGCGGGCGACGGCAGGGCATGGAGTGCCGTGGCGGCCCATCTCTGCCTGGACGAC
TGGTACAACATGGCGTACGAGTTTGTCTTTTGTGCTGTCAATTTGCGAAGCTGGAGCGTGCAGTATACCGTCAGC
GGGCCCAAAAAGGACTATAGCATCAAGGGCACGTATACGCGCTAG
Transcript >OphauB2|1086
ATGGCCAAATCTGTTTGCATTGTGGGGGCGGGACCGTCGGGCGTCGTGGCGGCCAAGACGCTTGTGCACAATGCG
GGCGGAGGATTTCGCGTCAGTCTGTTTGAGGCACAGAACAGCGTGGGCGGTCTATGGCCCAGCAGAGACGACAAG
AGCCAAGGTCGCCTGATTGACGGGCTCATGGTATGTAACCAGAGCCAGCACACGATGCATTTTAGCGACATGGCG
TGGGAAGCCGAGACGGGGCAGATGCCGAGGGCCTGGCAGGTGGGACGGTATATTGAAGGCTATGTGGAGCGGTAT
CTCGACGGACAGCCGGCATTCACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGAGGAGAGGGAAGGCGGGTGG
GAGATTGAGACGTCCAAGGGGGAGAGAGAGAGGTTTGAGTATTTAGTCGTTGCGTCGGGATATTTTGGAGAGGCG
CGCATGGCGGACGAGGTCAAGGGGGCTTCAGTGCCGGTAGTGCATAGCAGTGCGTACACGGGGCTGCATCAGCTG
CTCCAGGGAAGCGAGCTGGGGCCAGAGGCAAAGATCTTGGTGGTGGGAGGGCAGTTGTCGGGCGTGGAGGCTGCC
GCGGCGGTGGCCAGAGATATATCGACGGCGAGGCATGGAGAGAGGGAGAGCGGGGTCAAGAATGTCGAGACACTG
AGCGTTGAGCACATTGTGCAACACCCAGTGTGGATATTTCCGCTCTATACATGTCCCAAGCCTGAAGAAGCGGCG
CCGTCCTTCTTACCGCTGGATTGCTGTTCGTACAACCTGGCGAATAGAAGTGTCCCGCTAGAGAATACGCAGGGA
CATGTAAGTGTTGGAGCAGCGCGGAGAATGCATGCCTTGTTCGAGGCAGTCGTGGGGACTGACCAGAGCGAGTTT
GGCCTGCGGATTGGGGAGGAGGAGAGGGACGAGGTGCCCTACTTGGCCATGAGTGATGTGTATGCCGACTTTGTG
CGCAGCGGTTTGATTTCAGTGGTCAAGGGGAGGCTTGCTTGGGTGCGGGCGGACAAGACGGCCTCAGTGGACGCT
GCGACGAAATGTTTGCACAGCGCCGAGCAAGCTCCTCGGCCCAAGACGGCCACGGCAGTCCTAGCAAGCGGCAGG
CAAATCGCCAATGTGGCAGCCATGATATCAGCCACGGGCTTCGACGCGGCGTCCAGCCTTGACTTCTTGCCAGCG
TCGGTATTGGATAAGCTTGGCTTGGCGCCCGAGCACGGGGGACAGGTGCTGGCGCTGGGAATGCACGCAACGCTG
CATGCCAATGTGGCGCGGCTGGGGTTTGTTGGATTTTACCGGTCGCCGTACTGGGGGGTTATGCAGATGCAGGCG
AGGCTGTTGGCTGCGCTGTGGAGCTTGGGGCAGGAGGACAAGAGGGGGAAGCAAGTCGAGCAAGCGGTCAAGAGG
GGAGAGAAGAAACAAGAGACGGAAGAGACCAGGGAGGACAAGATGGCGACAAGCCATGGCCATGCAGAGGTTTCC
AAGGCCCAAAAGGAGAGAATGGAGAAGGAGGAGGGCGAGCAAGACGAGGGCAAAAGGGCCCAAAATCAACTGTGC
CGAGCCCTGGCGGCCGACGACTCCATTGCCCGCACCCTCGCCCTACGCAACGACGCTCGCCTCTCCCAGTTCCCC
ATGGGCGACTACCCCTGGCTGATGCAAGAATTCTCGTCGGCTCTCTGCATCCCGCTTGTCCCCATGCCGGCGCCT
CTCAACTCCCTCTGCCCAGCACGCTACCCTTGCCCCCACGACGACGCCCAAGCCCAAGCCCAAGCCGCCGCCTCT
CGAGCCAGCCTCGCACAAACAATCTCTTCTGCCTTGTCGTCCCCGCGCTTCGTCCCCCGCGCCGTATTTCGCAGC
CTGCTGGGGAAATGGAATCTTCAACGCAGCGTCACGTCTCGCTCACCATCTCACCCCAGTGGTCTATTCTCCGGC
ACGGCAACCTTTTCCCTGCGCGACACGTCGCCTCTGGAATCGAGCTTGGGCTTTGAGTATGTCTACCGTGAGGAC
GGCACCTTTTGCGCCTCAGACTTGCGGCTCGAGTTTCGGGCGTCGAGGAGCTATGTCTGGCGCTATCATGAGGCG
AGCAATGTCGTGTCGGTGTGGTTTGTGCGTACCGATGGTCATGGGGCCAGGGCGGTGACGGACTACTTGTTTCAT
GAGCTCGAGTTTGGCCCTCGGGCGGGCGACGGCAGGGCATGGAGTGCCGTGGCGGCCCATCTCTGCCTGGACGAC
TGGTACAACATGGCGTACGAGTTTGTCTTTTGTGCTGTCAATTTGCGAAGCTGGAGCGTGCAGTATACCGTCAGC
GGGCCCAAAAAGGACTATAGCATCAAGGGCACGTATACGCGCTAG
Gene >OphauB2|1086
ATGGCCAAATCTGTTTGCATTGTGGGCACGTCGACCCCACTCCCCTCTTGCCGGGAGGATGCTTGGCAAAGGGAG
AGAATTGACTGACGATATGCTTTTCTCCGGCACAGGGGCGGGACCGTCGGGCGTCGTGGCGGCCAAGACGCTTGT
GCACAATGCGGGCGGAGGATTTCGCGTCAGTCTGTTTGAGGCACAGAACAGCGTGGGCGGTCTATGGCCCAGCAG
AGACGACAAGAGCCAAGGTCGCCTGATTGACGGGCTCATGGTATGTAACCAGAGCCAGCACACGATGCATTTTAG
CGACATGGCGTGGGAAGCCGAGACGGGGCAGATGCCGAGGGCCTGGCAGGTGGGACGGTATATTGAAGGCTATGT
GGAGCGGTATCTCGACGGACAGCCGGCATTCACGCTGCGGCTGTCGACGAGGGTGGTCAAGGCGGAGGAGAGGGA
AGGCGGGTGGGAGATTGAGACGTCCAAGGGGGAGAGAGAGAGGTTTGAGTATTTAGTCGTTGCGTCGGGATATTT
TGGAGAGGCGCGCATGGCGGACGAGGTCAAGGGGGCTTCAGTGCCGGTAGTGCATAGCAGTGCGTACACGGGGCT
GCATCAGCTGCTCCAGGGAAGCGAGCTGGGGCCAGAGGCAAAGATCTTGGTGGTGGGAGGGCAGTTGTCGGGCGT
GGAGGCTGCCGCGGCGGTGGCCAGAGATATATCGACGGCGAGGCATGGAGAGAGGGAGAGCGGGGTCAAGAATGT
CGAGACACTGAGCGTTGAGCACATTGTGCAACACCCAGTGTGGATATTTCCGCTCTATACATGTCCCAAGGTGAG
TATTCAAACAAGAAGCAAGGAGTCAAGACTAACCTCGCTCTTTCTTGTCAATCCTTGGTGCTATAGCCTGAAGAA
GCGGCGCCGTCCTTCTTACCGCTGGATTGCTGTTCGTACAACCTGGCGAATAGAAGTGTCCCGCTAGAGAATACG
CAGGGACATGTAAGTGTTGGAGCAGCGCGGAGAATGCATGCCTTGTTCGAGGCAGTCGTGGGGACTGACCAGAGC
GAGTTTGGCCTGCGGATTGGGGAGGAGGAGAGGGACGAGGTGCCCTACTTGGCCATGAGTGATGTGTATGCCGAC
TTTGTGCGCAGCGGTTTGATTTCAGTGGTCAAGGGGAGGCTTGCTTGGGTGCGGGCGGACAAGACGGCCTCAGTG
GACGCTGCGACGAAATGTTTGCACAGCGCCGAGCAAGCTCCTCGGCCCAAGACGGCCACGGCAGTCCTAGCAAGC
GGCAGGCAAATCGCCAATGTGGCAGCCATGATATCAGCCACGGGCTTCGACGCGGCGTCCAGCCTTGACTTCTTG
CCAGCGTCGGTATTGGATAAGCTTGGCTTGGCGCCCGAGCACGGGGGACAGGTGCTGGCGCTGGGAATGCACGCA
ACGCTGCATGCCAATGTGGCGCGGCTGGGGTTTGTTGGATTTTACCGGTCGCCGTACTGGGGGGTTATGCAGATG
CAGGCGAGGCTGTTGGCTGCGCTGTGGAGCTTGGGGCAGGAGGACAAGAGGGGGAAGCAAGTCGAGCAAGCGGTC
AAGAGGGGAGAGAAGAAACAAGAGACGGAAGAGACCAGGGAGGACAAGATGGCGACAAGCCATGGCCATGCAGAG
GTTTCCAAGGCCCAAAAGGAGAGAATGGAGAAGGAGGAGGGCGAGCAAGACGAGGGCAAAAGGGCCCAAAATCAA
CTGTGCCGAGCCCTGGCGGCCGACGACTCCATTGCCCGCACCCTCGCCCTACGCAACGACGCTCGCCTCTCCCAG
TTCCCCATGGGCGACTACCCCTGGCTGATGCAAGAATTCTCGTCGGCTCTCTGCATCCCGCTTGTCCCCATGCCG
GCGCCTCTCAACTCCCTCTGCCCAGCACGCTACCCTTGCCCCCACGACGACGCCCAAGCCCAAGCCCAAGCCGCC
GCCTCTCGAGCCAGCCTCGCACAAACAATCTCTTCTGCCTTGTCGTCCCCGCGCTTCGTCCCCCGCGCCGTATTT
CGCAGCCTGCTGGGGAAATGGAATCTTCAACGCAGCGTCACGTCTCGCTCACCATCTCACCCCAGTGGTCTATTC
TCCGGCACGGCAACCTTTTCCCTGCGCGACACGTCGCCTCTGGAATCGAGCTTGGGCTTTGAGTATGTCTACCGT
GAGGACGGCACCTTTTGCGCCTCAGACTTGCGGCTCGAGTTTCGGGCGTCGAGGAGCTATGTCTGGCGCTATCAT
GAGGCGAGCAATGTCGTGTCGGTGTGGTTTGTGCGTACCGATGGTCATGGGGCCAGGGCGGTGACGGACTACTTG
TTTCATGAGCTCGAGTTTGGCCCTCGGGCGGGCGACGGCAGGGCATGGAGTGCCGTGGCGGCCCATCTCTGCCTG
GACGACTGGTACAACATGGCGTACGAGTTTGTCTTTTGTGCTGTCAATTTGCGAAGCTGGAGCGTGCAGTATACC
GTCAGCGGGCCCAAAAAGGACTATAGCATCAAGGGCACGTATACGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail