Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1079
Gene name
LocationContig_125:18863..21340
Strand+
Gene length (bp)2477
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09423 PhoD PhoD-like phosphatase 1.7E-106 205 559
PF16655 PhoD_N PhoD-like phosphatase, N-terminal domain 7.5E-28 70 192

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P42251|PPBD_BACSU Alkaline phosphatase D OS=Bacillus subtilis (strain 168) GN=phoD PE=1 SV=3 68 611 1.0E-71
sp|Q8KRU5|PLD_STRCW Phospholipase D OS=Streptomyces chromofuscus GN=pld PE=1 SV=2 68 589 3.0E-64

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1079
MRHLAALFSLVAVAAGLVFDGNLNYASPSRRHASLGIDVELVERRLKKRSLSSPSDYQPPTTSPKLHFTHGVASG
DPWPESVILWTRVAPTNESNASEATVNGTAPLYSHETERFIKADAHPICVAWSVYESQGPDGRLPGHAVAAGQTY
TTSDIDYTVKVEAKGLTPHTQYLYQFTICGTKTKSPLGRTKTAPRPDDDVSSLSFAVFSCSNYPNGYFNAYGNAA
RKDQHDYVIHLGDYIYEYNLGGPRAARPSRILFTLHDYRTRHGQYRSDADLQLLSKDFAWIPTWDDHEFANNGYR
DGFQGLNNTEDSFLNKGPRVSVDTRKVNAVRSYFEWMPIRQTDLDDGLRVWRSFQMGKLLDLIMVDTRNYDRSIT
SLDWNDDYIDLIRDDASRTLMGARQENWFYRSLTQSQERGATWRVVGNQIIFSRVFEDDSGLLSGDNWNGYIANR
NRTLQHLYDNKMDNTIFLSGDSHENWVSDLAWLGTRPYDKDSGKGAVGVEFAGTAVSSGGHSRNGPIEPTVGNYS
RGMIRRNDEMQWQEGWYRGYFVLSISPDAATARYFGTPSVATRNSWDISLANFTIRAGQNHLERPVAGGVVESGA
LRGGRVRHTNQTLNTDSGEYKVVGFDKMYL*
Coding >OphauB2|1079
ATGAGGCATCTCGCCGCCCTTTTCAGCCTCGTCGCCGTTGCAGCCGGTCTCGTCTTTGATGGCAATCTCAACTAC
GCCAGCCCTTCGCGGCGCCACGCCAGTCTGGGCATCGACGTTGAGCTTGTGGAGCGACGCCTCAAGAAGCGCAGT
CTAAGCAGCCCCAGTGACTACCAGCCGCCCACCACGTCGCCCAAGCTGCACTTTACTCATGGCGTCGCTTCTGGC
GATCCTTGGCCCGAGAGCGTCATTCTCTGGACTCGCGTTGCACCCACAAACGAGTCTAATGCTAGTGAAGCCACT
GTCAATGGCACTGCTCCCCTGTACAGCCATGAGACGGAGCGCTTTATAAAGGCGGATGCTCACCCCATCTGTGTG
GCATGGAGTGTCTATGAGAGCCAAGGCCCCGATGGGAGACTGCCGGGCCACGCCGTTGCCGCCGGCCAGACTTAT
ACCACGTCTGATATCGACTACACGGTCAAGGTCGAGGCCAAGGGGCTCACGCCACACACGCAGTACCTTTACCAG
TTTACCATTTGCGGAACCAAGACCAAGAGTCCGCTGGGCCGAACCAAGACGGCGCCAAGGCCCGACGATGACGTG
TCGTCGCTCAGCTTCGCCGTCTTTTCCTGCAGCAACTATCCAAACGGCTACTTCAATGCCTACGGCAACGCGGCC
CGCAAGGACCAGCATGACTATGTCATTCATCTCGGTGACTACATATACGAGTATAACCTGGGCGGTCCACGTGCT
GCCCGGCCCAGCCGCATTCTCTTTACCCTGCACGACTACCGCACCCGTCACGGCCAGTACCGGTCCGATGCTGAC
TTGCAGCTGCTGTCCAAAGACTTTGCCTGGATCCCGACGTGGGACGACCACGAGTTTGCCAATAATGGCTATCGT
GACGGCTTCCAGGGCCTCAACAATACTGAAGACTCGTTTCTCAACAAGGGCCCCAGAGTCAGTGTTGACACTCGC
AAGGTCAATGCCGTCCGCTCCTACTTTGAGTGGATGCCAATTCGCCAAACCGACCTTGACGATGGCCTACGGGTT
TGGCGCTCGTTCCAAATGGGCAAGCTGCTGGATCTAATCATGGTTGATACGCGCAACTACGATCGTAGCATAACT
TCACTTGATTGGAACGACGACTACATTGACTTGATTCGAGATGATGCTAGCCGCACACTTATGGGTGCACGGCAG
GAGAATTGGTTCTATCGGTCCCTGACCCAGTCGCAAGAGCGCGGGGCCACCTGGCGAGTGGTGGGAAACCAAATC
ATTTTTTCACGCGTCTTTGAAGATGACTCGGGGCTGCTGAGTGGCGACAATTGGAACGGCTACATTGCTAACCGC
AACCGCACGCTTCAACACTTGTATGATAATAAGATGGATAACACCATTTTTTTATCGGGCGACAGCCATGAAAAC
TGGGTGTCTGACCTTGCCTGGCTTGGCACAAGACCCTACGACAAGGACAGCGGCAAGGGCGCCGTTGGAGTTGAA
TTCGCCGGCACGGCGGTTAGCTCTGGCGGACACAGCAGAAACGGCCCCATTGAGCCCACTGTGGGCAATTATTCG
CGCGGCATGATTCGCCGCAACGACGAGATGCAGTGGCAAGAGGGCTGGTATCGCGGCTACTTTGTCCTGAGCATC
TCGCCCGACGCGGCGACGGCGCGGTATTTTGGCACACCCTCGGTGGCTACACGCAACTCGTGGGACATTTCGCTC
GCCAACTTTACTATTCGCGCCGGCCAAAACCACTTGGAGCGGCCAGTTGCCGGCGGCGTTGTAGAGTCGGGCGCG
CTGCGGGGCGGACGCGTCAGACATACCAACCAGACGCTCAATACCGACTCGGGCGAGTACAAGGTGGTTGGCTTT
GACAAAATGTATCTCTAG
Transcript >OphauB2|1079
ATGAGGCATCTCGCCGCCCTTTTCAGCCTCGTCGCCGTTGCAGCCGGTCTCGTCTTTGATGGCAATCTCAACTAC
GCCAGCCCTTCGCGGCGCCACGCCAGTCTGGGCATCGACGTTGAGCTTGTGGAGCGACGCCTCAAGAAGCGCAGT
CTAAGCAGCCCCAGTGACTACCAGCCGCCCACCACGTCGCCCAAGCTGCACTTTACTCATGGCGTCGCTTCTGGC
GATCCTTGGCCCGAGAGCGTCATTCTCTGGACTCGCGTTGCACCCACAAACGAGTCTAATGCTAGTGAAGCCACT
GTCAATGGCACTGCTCCCCTGTACAGCCATGAGACGGAGCGCTTTATAAAGGCGGATGCTCACCCCATCTGTGTG
GCATGGAGTGTCTATGAGAGCCAAGGCCCCGATGGGAGACTGCCGGGCCACGCCGTTGCCGCCGGCCAGACTTAT
ACCACGTCTGATATCGACTACACGGTCAAGGTCGAGGCCAAGGGGCTCACGCCACACACGCAGTACCTTTACCAG
TTTACCATTTGCGGAACCAAGACCAAGAGTCCGCTGGGCCGAACCAAGACGGCGCCAAGGCCCGACGATGACGTG
TCGTCGCTCAGCTTCGCCGTCTTTTCCTGCAGCAACTATCCAAACGGCTACTTCAATGCCTACGGCAACGCGGCC
CGCAAGGACCAGCATGACTATGTCATTCATCTCGGTGACTACATATACGAGTATAACCTGGGCGGTCCACGTGCT
GCCCGGCCCAGCCGCATTCTCTTTACCCTGCACGACTACCGCACCCGTCACGGCCAGTACCGGTCCGATGCTGAC
TTGCAGCTGCTGTCCAAAGACTTTGCCTGGATCCCGACGTGGGACGACCACGAGTTTGCCAATAATGGCTATCGT
GACGGCTTCCAGGGCCTCAACAATACTGAAGACTCGTTTCTCAACAAGGGCCCCAGAGTCAGTGTTGACACTCGC
AAGGTCAATGCCGTCCGCTCCTACTTTGAGTGGATGCCAATTCGCCAAACCGACCTTGACGATGGCCTACGGGTT
TGGCGCTCGTTCCAAATGGGCAAGCTGCTGGATCTAATCATGGTTGATACGCGCAACTACGATCGTAGCATAACT
TCACTTGATTGGAACGACGACTACATTGACTTGATTCGAGATGATGCTAGCCGCACACTTATGGGTGCACGGCAG
GAGAATTGGTTCTATCGGTCCCTGACCCAGTCGCAAGAGCGCGGGGCCACCTGGCGAGTGGTGGGAAACCAAATC
ATTTTTTCACGCGTCTTTGAAGATGACTCGGGGCTGCTGAGTGGCGACAATTGGAACGGCTACATTGCTAACCGC
AACCGCACGCTTCAACACTTGTATGATAATAAGATGGATAACACCATTTTTTTATCGGGCGACAGCCATGAAAAC
TGGGTGTCTGACCTTGCCTGGCTTGGCACAAGACCCTACGACAAGGACAGCGGCAAGGGCGCCGTTGGAGTTGAA
TTCGCCGGCACGGCGGTTAGCTCTGGCGGACACAGCAGAAACGGCCCCATTGAGCCCACTGTGGGCAATTATTCG
CGCGGCATGATTCGCCGCAACGACGAGATGCAGTGGCAAGAGGGCTGGTATCGCGGCTACTTTGTCCTGAGCATC
TCGCCCGACGCGGCGACGGCGCGGTATTTTGGCACACCCTCGGTGGCTACACGCAACTCGTGGGACATTTCGCTC
GCCAACTTTACTATTCGCGCCGGCCAAAACCACTTGGAGCGGCCAGTTGCCGGCGGCGTTGTAGAGTCGGGCGCG
CTGCGGGGCGGACGCGTCAGACATACCAACCAGACGCTCAATACCGACTCGGGCGAGTACAAGGTGGTTGGCTTT
GACAAAATGTATCTCTAG
Gene >OphauB2|1079
ATGAGGCATCTCGCCGCCCTTTTCAGCCTCGTCGCCGTTGCAGCCGGTCTCGTCTTTGATGGCAATCTCAACTAC
GCCAGCCCTTCGCGGCGCCACGCCAGTCTGGGCATCGACGTTGAGCTTGTGGAGCGACGCCTCAAGAAGCGCAGT
CTAAGCAGCCCCAGTGACTACCAGCCGCCCACCACGTCGCCCAAGCTGCACTTTACTCATGGCGTCGCTTCTGGC
GATCCTTGGCCCGAGAGCGTCATTCTCTGGACTCGCGTTGCACCCACAAACGAGTCTAATGCTAGTGAAGCCACT
GTCAATGGCACTGCTCCCCTGTACAGCCATGAGACGGAGCGCTTTATAAAGGCGGATGCTCACCCCATCTGTGTG
GCATGGAGTGTCTATGAGAGCCAAGGCCCCGATGGGAGACTGCCGGGCCACGCCGTTGCCGCCGGCCAGACTTAT
ACCACGTCTGATATCGACTACACGGTCAAGGCAAGGCCATGTGCGCTCGAGCAGACATTGGCCAAGGACTAATGG
CCCTGCTATCCAGGTCGAGGCCAAGGGGCTCACGCCACACACGCAGTACCTTTACCAGTTTACCATTTGCGGAAC
CAAGACCAAGAGTCCGCTGGGCCGAACCAAGACGGCGCCAAGGCCCGACGATGACGTGTCGTCGCTCAGCTTCGC
CGTCTTTTCCTGCAGCAACTATCGTCAGTGGCCACTGTCATTATTGACTCGAGGCAAAGGCTGGTACTGACGGTT
GGCGCAAAAGCAAACGGCTACTTCAATGCCTACGGCAACGCGGCCCGCAAGGACCAGCATGACTATGTCATTCAT
CTCGGTGACTACATATACGAGTATAACCTGGGCGGTCCACGTGCTGCCCGGCCCAGCCGCATTCTCTTTACCCTG
CACGACTACCGCACCCGTCACGGCCAGGTTGTAGCCCTCGTCTCTTGGCCATTGCTTCTTGCCGCCGGTGGCTGA
CCTGAAACAGTACCGGTCCGATGCTGACTTGCAGCTGCTGTCCAAAGACTTTGCCTGGATCCCGACGTGGGACGA
CCACGGTTGGTCAAGACGTATGCGCATGCCGGCAGCTTTGTGGGCTGACGAGTGTAGAGTTTGCCAATAATGGCT
ATCGTGACGGCTTCCAGGGCCTCAACAATACTGAAGACTCGTTTCTCAACAAGGGCCCCAGAGTCAGTGTTGACA
CTCGCAAGGTCAATGCCGTCCGCTCCTACTTTGAGTGGATGCCAATTCGGTGGGTGTGCCGGCCAAGAAGCACTA
GTCTAGCATGCTGACGCACACGACAGCCAAACCGACCTTGACGATGGCCTACGGGTTTGGCGCTCGTTCCAAATG
GGCAAGCTGCTGGATCTAATCATGGTTGATACGCGCAACTACGATCGTAGCATAACTTCACTTGGTACCAACCCA
AGCCAGATGGATGGCAGCAAGCGCAACTAATGGCAAGCCACAGATTGGAACGACGACTACATTGACTTGATTCGA
GATGATGCTAGCCGCACACTTATGGGTGCACGGCAGGAGAATTGGTTCTATCGGTCCCTGACCCAGTCGCAAGAG
CGCGGGGCCACCTGGCGAGTGGTGGGAAACCAAATCATTTTTTCACGCGTCTTTGAAGATGACTCGGGGCTGCTG
AGTGGCGACAATTGGAACGCAAGTTTTGTGTGCCCTTGATTGCTTTCCGAAGCGCTGTTAACGGTGGCGCAGGGC
TACATTGCTAACCGCAACCGCACGCTTCAACACTTGTATGATAATAAGATGGATAACACCATTTTTTTATCGGGC
GACAGCCATGAAAACTGGGTACGCAGTCCACCAATGATGGGCCCCTGAGGATATCTGACCTTTGGAATTAGGTGT
CTGACCTTGCCTGGCTTGGCACAAGACCCTACGACAAGGACAGCGGCAAGGGCGCCGTTGGAGTTGAATTCGCCG
GCACGGCGGTTAGCTCTGGCGGACACAGCAGAAACGGCCCCATTGAGCCCACTGTGGGCAATTATTCGCGCGGCA
TGATTCGCCGCAACGACGAGATGCAGTGGCAAGAGGGCTGGTATCGCGGCTACTTTGTCCTGAGCATCTCGCCCG
ACGCGGCGACGGCGCGGTATTTTGGTACGCCTTTTTTGCTCTTTTTCCTCTTCTCCCTTTTTTTTTCCTTTTCTC
CCTTTTTTCTTTCTCTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNTTTCTCCAAGGCACACCCTCGGTGGCTACACGCAACTCGTGGGACATTTCGCTCGCCAACTTTACTATTC
GCGCCGGCCAAAACCACTTGGAGCGGCCAGTTGCCGGCGGCGTTGTAGAGTCGGGCGCGCTGCGGGGCGGACGCG
TCAGACATACCAACCAGACGCTCAATACCGACTCGGGCGAGTACAAGGTGGTTGGCTTTGACAAAATGTATCTCT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail