Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1064
Gene name
LocationContig_124:49725..50751
Strand-
Gene length (bp)1026
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.4E-10 128 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74776|MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtg1 PE=3 SV=1 3 311 6.0E-44
sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 19 306 2.0E-43
sp|Q03151|MTG1_YEAST Mitochondrial GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG1 PE=1 SV=1 1 297 1.0E-32
sp|Q9BT17|MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens GN=MTG1 PE=1 SV=2 7 302 2.0E-32
sp|A9JTX2|MTG1_XENTR Mitochondrial ribosome-associated GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 3 302 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74776|MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtg1 PE=3 SV=1 3 311 6.0E-44
sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 19 306 2.0E-43
sp|Q03151|MTG1_YEAST Mitochondrial GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG1 PE=1 SV=1 1 297 1.0E-32
sp|Q9BT17|MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens GN=MTG1 PE=1 SV=2 7 302 2.0E-32
sp|A9JTX2|MTG1_XENTR Mitochondrial ribosome-associated GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 3 302 3.0E-32
sp|E3TDS3|MTG1_ICTPU Mitochondrial ribosome-associated GTPase 1 OS=Ictalurus punctatus GN=mtg1 PE=2 SV=1 2 302 1.0E-30
sp|Q8R2R6|MTG1_MOUSE Mitochondrial ribosome-associated GTPase 1 OS=Mus musculus GN=Mtg1 PE=1 SV=2 7 302 2.0E-29
sp|Q4PS77|MTG1_BOVIN Mitochondrial ribosome-associated GTPase 1 OS=Bos taurus GN=MTG1 PE=2 SV=2 7 302 1.0E-27
sp|Q9VCU5|MTG1_DROME Mitochondrial ribosome-associated GTPase 1 OS=Drosophila melanogaster GN=CG17141 PE=1 SV=2 7 305 5.0E-25
sp|Q17EJ1|MTG1_AEDAE Mitochondrial GTPase 1 OS=Aedes aegypti GN=AAEL003813 PE=3 SV=1 9 303 1.0E-23
sp|Q29AU5|MTG1_DROPS Mitochondrial GTPase 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14342 PE=3 SV=2 7 303 5.0E-22
sp|B7GGD6|RBGA_ANOFW Ribosome biogenesis GTPase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rbgA PE=3 SV=1 14 302 4.0E-21
sp|Q8L607|SIN2_ARATH Short integuments 2, mitochondrial OS=Arabidopsis thaliana GN=SIN2 PE=1 SV=1 10 251 1.0E-20
sp|C5D8U8|RBGA_GEOSW Ribosome biogenesis GTPase A OS=Geobacillus sp. (strain WCH70) GN=rbgA PE=3 SV=1 20 298 4.0E-18
sp|Q819W8|RBGA_BACCR Ribosome biogenesis GTPase A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbgA PE=3 SV=1 20 298 7.0E-18
sp|D5DJL5|RBGA_BACMD Ribosome biogenesis GTPase A OS=Bacillus megaterium (strain DSM 319) GN=rbgA PE=3 SV=1 20 306 1.0E-17
sp|E0TTS5|RBGA_BACPZ Ribosome biogenesis GTPase A OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=rbgA PE=3 SV=1 20 298 3.0E-17
sp|O31743|RBGA_BACSU Ribosome biogenesis GTPase A OS=Bacillus subtilis (strain 168) GN=rbgA PE=1 SV=1 20 298 5.0E-17
sp|A8FD69|RBGA_BACP2 Ribosome biogenesis GTPase A OS=Bacillus pumilus (strain SAFR-032) GN=rbgA PE=3 SV=1 20 297 6.0E-15
sp|Q65JP4|RBGA_BACLD Ribosome biogenesis GTPase A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbgA PE=3 SV=1 20 297 2.0E-14
sp|O82497|DGP2_ARATH DAR GTPase 2, mitochondrial OS=Arabidopsis thaliana GN=DGP2 PE=3 SV=1 13 242 1.0E-12
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 11 298 2.0E-12
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 129 296 8.0E-12
sp|P75135|RBGA_MYCPN Probable ribosome biogenesis GTPase A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rbgA PE=1 SV=1 12 227 6.0E-10
sp|Q9WZM6|RBGA_THEMA Ribosome biogenesis GTPase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbgA PE=1 SV=1 19 298 3.0E-09
sp|Q49435|RBGA_MYCGE Probable ribosome biogenesis GTPase A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rbgA PE=3 SV=1 19 297 6.0E-08
sp|Q6DRP2|GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio GN=gnl3 PE=2 SV=1 30 298 7.0E-08
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 109 296 4.0E-07
sp|O14236|NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog2 PE=1 SV=1 34 303 5.0E-07
sp|Q9C923|NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana GN=NUG2 PE=1 SV=1 102 296 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1064
MASFVPRSSFAFASTIPKTYFIGHHVTGIQKMGQLLPTIGLIVECRDSRLPLSTKNGVLDRLVAGRQRLVVYTKS
DLGATTAQAQKHLAGLCRDPVVFWAKNKPQSTRSIIAHFRSLAHRQDSILALRVLIIGMPNVGKSSLLNSLRCHG
ASNPRTGSTHKVAPTSNHAGCTRKVGTPVCIVPSHDKGGVAAGVYLLDSPGVFQPFVQDAETMVKIALALGVKNG
LVHDEILADYLLYRLNLWDPALYQRYCPPTNDIDVVLGCIAKRLGKLKAGGLPNIAQAAAQFLNQWRIGALGHNI
LDDISDTALTLHEALLHEPPLSLNQARKSHAQQLKLNRMPT*
Coding >OphauB2|1064
ATGGCGTCCTTTGTTCCGCGCTCGTCGTTTGCCTTTGCATCAACAATCCCCAAGACTTACTTTATCGGCCACCAT
GTCACGGGCATACAGAAAATGGGCCAGCTGCTCCCCACCATTGGCCTCATTGTCGAGTGCCGCGACAGTCGCCTT
CCCCTCTCGACCAAGAACGGCGTGCTGGACCGTCTGGTGGCTGGCCGCCAGCGCCTCGTTGTCTACACAAAATCA
GACCTCGGCGCCACCACGGCCCAAGCCCAGAAGCACTTGGCCGGCCTGTGCAGGGACCCAGTCGTCTTTTGGGCC
AAGAATAAGCCCCAAAGCACGCGCTCCATTATAGCCCATTTCCGCAGCCTTGCTCACCGCCAAGACTCCATCTTG
GCCCTGCGCGTCCTCATTATTGGCATGCCCAACGTTGGCAAGAGCTCCCTGCTAAACAGCCTGCGCTGCCATGGC
GCCTCGAATCCGCGAACTGGCTCCACGCACAAGGTGGCGCCAACCAGCAACCACGCCGGCTGCACCCGCAAGGTC
GGCACTCCCGTCTGCATTGTCCCCTCCCACGACAAGGGCGGCGTCGCGGCCGGCGTCTATCTGCTCGACTCCCCC
GGCGTCTTCCAGCCCTTTGTCCAGGATGCCGAGACCATGGTCAAGATTGCTCTGGCTCTCGGCGTCAAGAATGGC
CTTGTCCATGACGAGATTCTCGCAGACTACCTCCTCTATCGCCTCAATCTCTGGGACCCTGCTCTTTACCAGCGC
TACTGCCCGCCCACAAACGACATTGATGTCGTCCTTGGCTGCATTGCCAAGCGTCTGGGCAAGCTCAAGGCTGGC
GGCCTGCCAAACATTGCCCAAGCCGCTGCCCAATTCCTCAACCAGTGGAGGATTGGCGCACTTGGCCACAATATC
CTCGACGACATCTCCGACACGGCCTTGACACTCCACGAGGCGCTGCTTCATGAGCCGCCTCTCAGCCTCAACCAA
GCCAGAAAGTCGCATGCCCAGCAGCTCAAGCTGAATCGCATGCCGACATAG
Transcript >OphauB2|1064
ATGGCGTCCTTTGTTCCGCGCTCGTCGTTTGCCTTTGCATCAACAATCCCCAAGACTTACTTTATCGGCCACCAT
GTCACGGGCATACAGAAAATGGGCCAGCTGCTCCCCACCATTGGCCTCATTGTCGAGTGCCGCGACAGTCGCCTT
CCCCTCTCGACCAAGAACGGCGTGCTGGACCGTCTGGTGGCTGGCCGCCAGCGCCTCGTTGTCTACACAAAATCA
GACCTCGGCGCCACCACGGCCCAAGCCCAGAAGCACTTGGCCGGCCTGTGCAGGGACCCAGTCGTCTTTTGGGCC
AAGAATAAGCCCCAAAGCACGCGCTCCATTATAGCCCATTTCCGCAGCCTTGCTCACCGCCAAGACTCCATCTTG
GCCCTGCGCGTCCTCATTATTGGCATGCCCAACGTTGGCAAGAGCTCCCTGCTAAACAGCCTGCGCTGCCATGGC
GCCTCGAATCCGCGAACTGGCTCCACGCACAAGGTGGCGCCAACCAGCAACCACGCCGGCTGCACCCGCAAGGTC
GGCACTCCCGTCTGCATTGTCCCCTCCCACGACAAGGGCGGCGTCGCGGCCGGCGTCTATCTGCTCGACTCCCCC
GGCGTCTTCCAGCCCTTTGTCCAGGATGCCGAGACCATGGTCAAGATTGCTCTGGCTCTCGGCGTCAAGAATGGC
CTTGTCCATGACGAGATTCTCGCAGACTACCTCCTCTATCGCCTCAATCTCTGGGACCCTGCTCTTTACCAGCGC
TACTGCCCGCCCACAAACGACATTGATGTCGTCCTTGGCTGCATTGCCAAGCGTCTGGGCAAGCTCAAGGCTGGC
GGCCTGCCAAACATTGCCCAAGCCGCTGCCCAATTCCTCAACCAGTGGAGGATTGGCGCACTTGGCCACAATATC
CTCGACGACATCTCCGACACGGCCTTGACACTCCACGAGGCGCTGCTTCATGAGCCGCCTCTCAGCCTCAACCAA
GCCAGAAAGTCGCATGCCCAGCAGCTCAAGCTGAATCGCATGCCGACATAG
Gene >OphauB2|1064
ATGGCGTCCTTTGTTCCGCGCTCGTCGTTTGCCTTTGCATCAACAATCCCCAAGACTTACTTTATCGGCCACCAT
GTCACGGGCATACAGAAAATGGGCCAGCTGCTCCCCACCATTGGCCTCATTGTCGAGTGCCGCGACAGTCGCCTT
CCCCTCTCGACCAAGAACGGCGTGCTGGACCGTCTGGTGGCTGGCCGCCAGCGCCTCGTTGTCTACACAAAATCA
GACCTCGGCGCCACCACGGCCCAAGCCCAGAAGCACTTGGCCGGCCTGTGCAGGGACCCAGTCGTCTTTTGGGCC
AAGAATAAGCCCCAAAGCACGCGCTCCATTATAGCCCATTTCCGCAGCCTTGCTCACCGCCAAGACTCCATCTTG
GCCCTGCGCGTCCTCATTATTGGCATGCCCAACGTTGGCAAGAGCTCCCTGCTAAACAGCCTGCGCTGCCATGGC
GCCTCGAATCCGCGAACTGGCTCCACGCACAAGGTGGCGCCAACCAGCAACCACGCCGGCTGCACCCGCAAGGTC
GGCACTCCCGTCTGCATTGTCCCCTCCCACGACAAGGGCGGCGTCGCGGCCGGCGTCTATCTGCTCGACTCCCCC
GGCGTCTTCCAGCCCTTTGTCCAGGATGCCGAGACCATGGTCAAGATTGCTCTGGCTCTCGGCGTCAAGAATGGC
CTTGTCCATGACGAGATTCTCGCAGACTACCTCCTCTATCGCCTCAATCTCTGGGACCCTGCTCTTTACCAGCGC
TACTGCCCGCCCACAAACGACATTGATGTCGTCCTTGGCTGCATTGCCAAGCGTCTGGGCAAGCTCAAGGCTGGC
GGCCTGCCAAACATTGCCCAAGCCGCTGCCCAATTCCTCAACCAGTGGAGGATTGGCGCACTTGGCCACAATATC
CTCGACGACATCTCCGACACGGCCTTGACACTCCACGAGGCGCTGCTTCATGAGCCGCCTCTCAGCCTCAACCAA
GCCAGAAAGTCGCATGCCCAGCAGCTCAAGCTGAATCGCATGCCGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail