Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1052
Gene name
LocationContig_124:13361..14664
Strand+
Gene length (bp)1303
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 6.1E-12 55 267

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08219|RRT8_YEAST Outer spore wall protein RRT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT8 PE=1 SV=2 31 282 5.0E-19
sp|P31379|LDS1_YEAST Outer spore wall protein LDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDS1 PE=1 SV=1 14 281 1.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 99 121 22
3 192 214 22
4 245 267 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1052
MADPSSCTGQSSSSESKRRRVANSVGEKAQQVLKEDYAKARSVAFDALKSRAFLYPFKGILYFLTHRTLWRPFIS
RLGPFATLSASVIAGMFTLTYLPQLAVQVFVSGPFAVVSTVLLVLSESSAIINVIARTWLLQDAILDTFDGTLLS
RNATVMLREGREIKSGRDSIQKLGKIIKSPFERFSPKALVRYLMYLPLNFVPLVGTVMFIYLQGRNRGRQVHGRY
FQLKKWSTGQQKDWLNKHVGAYTAFGLVATLLEMVPLASIFFTYTNAVGAALWAADIETFNTSMTDGTAPGLRET
AKDSE*
Coding >OphauB2|1052
ATGGCCGACCCATCATCCTGCACTGGTCAAAGTTCTAGCTCCGAGTCAAAGAGGCGCCGCGTTGCCAACTCGGTG
GGTGAAAAGGCCCAGCAGGTTCTCAAGGAGGATTACGCCAAGGCCCGCTCCGTCGCCTTTGACGCGCTCAAGAGC
CGTGCTTTCCTGTATCCCTTCAAGGGAATTCTCTACTTTCTCACCCACCGCACGCTGTGGCGACCCTTCATCTCC
CGTCTGGGTCCCTTTGCCACTCTTTCTGCCAGCGTAATTGCTGGCATGTTTACCCTGACCTACCTGCCTCAGTTG
GCCGTGCAGGTTTTTGTCAGCGGACCCTTTGCCGTTGTCTCCACTGTGTTGCTTGTCCTTAGTGAGAGCTCGGCA
ATCATCAACGTTATTGCTCGCACATGGCTGCTTCAAGACGCCATCCTTGACACTTTTGACGGCACGCTGCTGAGT
CGTAACGCCACAGTCATGCTTAGAGAGGGTCGCGAAATCAAGTCTGGTCGCGATTCGATACAGAAGCTCGGCAAA
ATCATCAAGAGCCCCTTTGAACGCTTTAGCCCAAAGGCTCTCGTGCGCTATCTCATGTATCTACCGCTCAACTTT
GTGCCTCTTGTCGGCACCGTCATGTTCATATATCTTCAGGGCCGGAACCGTGGTCGACAAGTTCACGGTCGGTAT
TTCCAGCTCAAGAAGTGGTCGACTGGGCAACAAAAGGATTGGCTCAACAAACACGTCGGAGCTTACACTGCCTTT
GGGTTGGTTGCTACACTCCTCGAGATGGTACCACTGGCATCCATTTTTTTCACGTATACAAACGCAGTGGGAGCT
GCTCTGTGGGCGGCAGACATTGAGACTTTCAACACATCCATGACGGATGGAACTGCCCCTGGCCTAAGGGAGACA
GCCAAAGACTCTGAGTGA
Transcript >OphauB2|1052
ATGGCCGACCCATCATCCTGCACTGGTCAAAGTTCTAGCTCCGAGTCAAAGAGGCGCCGCGTTGCCAACTCGGTG
GGTGAAAAGGCCCAGCAGGTTCTCAAGGAGGATTACGCCAAGGCCCGCTCCGTCGCCTTTGACGCGCTCAAGAGC
CGTGCTTTCCTGTATCCCTTCAAGGGAATTCTCTACTTTCTCACCCACCGCACGCTGTGGCGACCCTTCATCTCC
CGTCTGGGTCCCTTTGCCACTCTTTCTGCCAGCGTAATTGCTGGCATGTTTACCCTGACCTACCTGCCTCAGTTG
GCCGTGCAGGTTTTTGTCAGCGGACCCTTTGCCGTTGTCTCCACTGTGTTGCTTGTCCTTAGTGAGAGCTCGGCA
ATCATCAACGTTATTGCTCGCACATGGCTGCTTCAAGACGCCATCCTTGACACTTTTGACGGCACGCTGCTGAGT
CGTAACGCCACAGTCATGCTTAGAGAGGGTCGCGAAATCAAGTCTGGTCGCGATTCGATACAGAAGCTCGGCAAA
ATCATCAAGAGCCCCTTTGAACGCTTTAGCCCAAAGGCTCTCGTGCGCTATCTCATGTATCTACCGCTCAACTTT
GTGCCTCTTGTCGGCACCGTCATGTTCATATATCTTCAGGGCCGGAACCGTGGTCGACAAGTTCACGGTCGGTAT
TTCCAGCTCAAGAAGTGGTCGACTGGGCAACAAAAGGATTGGCTCAACAAACACGTCGGAGCTTACACTGCCTTT
GGGTTGGTTGCTACACTCCTCGAGATGGTACCACTGGCATCCATTTTTTTCACGTATACAAACGCAGTGGGAGCT
GCTCTGTGGGCGGCAGACATTGAGACTTTCAACACATCCATGACGGATGGAACTGCCCCTGGCCTAAGGGAGACA
GCCAAAGACTCTGAGTGA
Gene >OphauB2|1052
ATGGCCGACCCATCATCCTGCACTGGTCAAAGTTCTAGCTCCGAGTCAAAGAGGCGCCGCGTTGCCAACTCGGTG
GGTGAAAAGGCCCAGCAGGTTCTGTAGGCGCTCTTGACTGCCACGAACCCAGCCCAGCCGTGCGGCTAATCTCCC
ACTTGCAGCAAGGAGGATTACGCCAAGGCCCGCTCCGTCGCCTTTGACGCGCTCAAGAGCCGTGCTTTCCTGTAT
CCCTTCAAGGTAGGACTCGATACAGCCTCAGCTCCAGATAACCATTTATACCCCAAGTCTGACACAAAGGCAATG
GCTGCAATGCTCCAGGGAATTCTCTACTTTCTCACCCACCGCACGCTGTGGCGACCCTTCATCTCCCGTCTGGGT
CCCTTTGCCACTCTTTCTGCCAGCGTAATTGCTGGCATGTTTACCCTGACCTACCTGCCTCAGTTGGCCGTGCAG
GTTTTTGTCAGCGGACCCTTTGCCGTTGTCTCCACTGTGTTGCTTGTCCTTAGTGAGAGCTCGGCAATCATCAAC
GTTATTGCTCGCACATGGCTGCTTCAAGACGCCATCCTTGACACTTTTGACGGCACGCTGCTGAGTCGTAACGCC
ACAGTCATGCTTAGAGAGGGTCGCGAAATCAAGTCTGGTCGCGATTCGATACAGAAGCTCGGCAAAATCATCAAG
AGCCCCTTTGAACGCTTTAGCCCAAAGGCTCTCGTGCGCTATCTCATGTATCTACCGCTCAACTTTGTGCCTCTT
GTCGGCACCGTCATGTTCATATATCTTCAGGGTCTGTCACTTCAGTGTCTCAAGATATGCTTTAAATCTCTGGGC
TAATAGCTGTCTTAGGCCGGAACCGTGGTCGACAAGTTCACGGTCGGGTGAGTTTTCCATGCACAAACAAAAACA
AGACGCAGGACCTGACTTCTGGCCTAGTATTTCCAGCTCAAGAAGTGGTCGACTGGGCAACAAAAGGATTGGCTC
AACAAACACGTCGGAGCTTACACTGCGTATGTGTAACAGAACCCTCGACAAACTCTTTGTCATACCTATTGACCT
CTGGGCAAACAGCTTTGGGTTGGTTGCTACACTCCTCGAGATGGTACCACTGGCATCCATTTTTTTCACGTATAC
AAACGCAGGTAGACTTCCTTAAGGCCTTCATCCGGAACTGCCCAATCAAAAAAACTTTTGCTGACGTATTGTCAA
AGTGGGAGCTGCTCTGTGGGCGGCAGACATTGAGACTTTCAACACATCCATGACGGATGGAACTGCCCCTGGCCT
AAGGGAGACAGCCAAAGACTCTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail