Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1044
Gene name
LocationContig_123:46802..49826
Strand+
Gene length (bp)3024
Transcript length (bp)3024
Coding sequence length (bp)3024
Protein length (aa) 1008

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13181 TPR_8 Tetratricopeptide repeat 5.7E-03 681 707

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O36033|YLM1_SCHPO TPR repeat-containing protein C19B12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19B12.01 PE=3 SV=2 72 1004 4.0E-100
sp|Q54BW6|TTC27_DICDI Tetratricopeptide repeat protein 27 homolog OS=Dictyostelium discoideum GN=ttc27 PE=3 SV=1 23 1007 1.0E-56
sp|P42842|EMW1_YEAST Essential for maintenance of the cell wall protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMW1 PE=1 SV=1 176 993 9.0E-54
sp|Q5F3K0|TTC27_CHICK Tetratricopeptide repeat protein 27 OS=Gallus gallus GN=TTC27 PE=2 SV=1 73 751 4.0E-39
sp|Q17QZ7|TTC27_BOVIN Tetratricopeptide repeat protein 27 OS=Bos taurus GN=TTC27 PE=2 SV=1 71 750 5.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O36033|YLM1_SCHPO TPR repeat-containing protein C19B12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19B12.01 PE=3 SV=2 72 1004 4.0E-100
sp|Q54BW6|TTC27_DICDI Tetratricopeptide repeat protein 27 homolog OS=Dictyostelium discoideum GN=ttc27 PE=3 SV=1 23 1007 1.0E-56
sp|P42842|EMW1_YEAST Essential for maintenance of the cell wall protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMW1 PE=1 SV=1 176 993 9.0E-54
sp|Q5F3K0|TTC27_CHICK Tetratricopeptide repeat protein 27 OS=Gallus gallus GN=TTC27 PE=2 SV=1 73 751 4.0E-39
sp|Q17QZ7|TTC27_BOVIN Tetratricopeptide repeat protein 27 OS=Bos taurus GN=TTC27 PE=2 SV=1 71 750 5.0E-39
sp|Q5RBW9|TTC27_PONAB Tetratricopeptide repeat protein 27 OS=Pongo abelii GN=TTC27 PE=2 SV=1 30 750 1.0E-38
sp|Q6P3X3|TTC27_HUMAN Tetratricopeptide repeat protein 27 OS=Homo sapiens GN=TTC27 PE=1 SV=1 73 984 7.0E-38
sp|Q8CD92|TTC27_MOUSE Tetratricopeptide repeat protein 27 OS=Mus musculus GN=Ttc27 PE=1 SV=2 73 948 1.0E-34
sp|P41842|TTC27_CAEEL Tetratricopeptide repeat-containing protein trd-1 OS=Caenorhabditis elegans GN=trd-1 PE=2 SV=2 497 728 4.0E-08
sp|P41842|TTC27_CAEEL Tetratricopeptide repeat-containing protein trd-1 OS=Caenorhabditis elegans GN=trd-1 PE=2 SV=2 201 333 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1044
MDDASVKTSGPSAPQGVSTDNDDAIRPLLILSESRTAKDIIQTHVRQLVVSAPASLKPWCFASDDDGITPLDVGL
AALDAFLQANVTGPVLSPHLIARVEERFASAWRDNHIGSQATLPSLGNTCLKHLGVDGVAPYAYIPYLELFSLAR
YILVEAEGLLKQGNGTSWMRLRLHVWHYKLLTQPSLGPGSNFTKSSQWSDVPTLASTILEHMDLLLPLVSDYQPW
SQQEKAQFLIEAANNYILLGHYEKAKKTLRDAAQVNGLVYALSGALGKRTKFQDKDTSQLVVLARGRDAQVEGKL
GKVQDDAPELARPEALQLNDDTLLEDIDFAKDGNNGSNSASLPLALLHFSPDEQPQLSPLDQIILLTEATLKDAF
SPADSLTAEEMLPFAARVLADKSTNWQIFTQALLVRSRIEIHRSRTVERGVLQLQALADQVIVDTSAPPKQSVQS
AEAKSAALSAPTIKVTGAEHSDAHVKSQVASSFLPAAKASESASANVRLRYIHALSTPPRWHLESELAYAWAGVG
SLVSALEIFKRLRLWAEVALCFASAAAAEDEHGRGSGGEDKARAVIRWRLFHGTDDHGLTSTGPDDEGIEDLSLV
KASDYSGPERTPPPPNAPRLWCILGDLENNPSHYTRAWHLSQKRYARAQKSLGEYYVQQRDWPEALGAYQLATAV
NRLNPDLWCRLGDINLRLGHFEEAAEAYNRSIACTNDMAGGEDARTWSNLGSALWSLYSVKAARGEKKETTANTD
QDGDQDLTATEGQEQTDNIAALLSQSLAAYKKGASIAHDNWRIWDNVLTLAARVQPVPIADMVLALKHIIRIRRT
EDAIDATLLTALVQDAVLSRATTERLTSTDCVYQPPRGSPERLVTRLVEDDIVPLITRRSDLWALVSRLRGWRYD
YAAALDASERAWRAAAGSSGSGLLAGADAAAAADWTIDEAAWSDVVQRTDELVSALANWGPDVLGLQWRARARSA
LRSIMGRARDPWQGSEGWTILENHLEHLKVHK*
Coding >OphauB2|1044
ATGGACGATGCGTCAGTCAAGACGTCTGGTCCAAGCGCGCCTCAGGGCGTCTCTACCGACAATGACGATGCTATT
CGCCCTCTCTTAATTCTGTCAGAGAGCAGGACGGCAAAGGATATAATCCAGACCCATGTGCGCCAACTTGTCGTC
TCGGCGCCTGCTTCGCTGAAGCCGTGGTGTTTTGCCTCTGACGACGATGGCATCACCCCTCTCGACGTTGGGCTT
GCTGCTCTCGACGCTTTCCTACAGGCCAACGTTACAGGCCCGGTTCTCTCTCCTCATCTGATTGCGCGTGTCGAG
GAGCGGTTTGCTAGTGCTTGGAGGGACAACCACATTGGCAGTCAAGCCACTTTGCCCAGCCTTGGAAACACCTGC
CTCAAGCATCTTGGCGTTGATGGCGTGGCTCCTTATGCATATATACCATACCTAGAGCTGTTTTCTCTGGCCAGA
TATATATTGGTGGAGGCTGAGGGACTACTGAAACAAGGCAATGGCACATCATGGATGCGGCTGCGTCTTCATGTC
TGGCATTACAAGCTTCTTACACAGCCTAGCCTAGGTCCAGGGTCAAATTTTACCAAGAGCTCACAGTGGAGCGAT
GTGCCCACTCTGGCATCAACTATACTGGAACACATGGATCTTCTTCTGCCGCTTGTCTCTGATTACCAACCCTGG
AGTCAGCAAGAAAAAGCCCAGTTTCTAATAGAGGCGGCAAATAATTACATTCTGCTTGGTCACTATGAAAAAGCC
AAGAAGACGCTCAGAGATGCAGCACAAGTAAATGGGCTTGTCTATGCTCTATCCGGAGCTCTGGGCAAGAGGACC
AAATTCCAAGACAAGGACACCAGCCAGCTTGTAGTACTGGCTCGTGGCCGTGATGCCCAAGTGGAGGGCAAGCTT
GGAAAAGTCCAGGACGATGCTCCAGAACTTGCCAGGCCCGAGGCGCTGCAGCTAAATGACGACACTCTTCTCGAG
GATATTGACTTTGCAAAAGACGGCAACAATGGCTCCAACTCAGCTTCATTGCCTCTTGCTCTGCTTCATTTCTCC
CCAGACGAGCAGCCGCAGCTCTCTCCCCTCGACCAGATTATTCTCCTTACCGAGGCCACTCTCAAAGATGCCTTT
TCACCCGCTGATTCTTTGACTGCAGAGGAGATGTTACCCTTTGCTGCGCGCGTTCTGGCCGATAAGTCGACCAAC
TGGCAAATATTCACCCAAGCCCTACTTGTACGCTCGCGGATAGAAATCCATAGGAGCAGAACTGTTGAACGAGGC
GTGCTTCAGCTACAAGCATTAGCAGACCAGGTTATTGTCGACACATCAGCTCCACCAAAGCAATCTGTGCAGTCA
GCCGAGGCCAAATCTGCCGCTCTTTCGGCACCTACCATCAAAGTTACCGGGGCTGAGCACAGTGATGCTCATGTC
AAGAGTCAAGTAGCGTCATCGTTTTTGCCAGCAGCCAAAGCCTCGGAATCAGCTTCTGCCAATGTTCGTCTTCGC
TATATTCATGCGCTTTCTACGCCTCCCAGGTGGCATCTCGAGTCAGAGCTGGCGTATGCTTGGGCTGGCGTTGGA
TCATTGGTGTCTGCTCTTGAAATCTTTAAACGACTGCGGCTCTGGGCAGAAGTAGCCTTGTGCTTTGCCAGTGCA
GCAGCAGCAGAAGACGAGCATGGCCGGGGCAGCGGGGGCGAGGACAAGGCTAGAGCAGTTATCCGCTGGCGTCTA
TTCCATGGTACAGACGACCATGGCTTGACAAGTACTGGACCAGACGACGAAGGCATCGAGGACCTGTCACTTGTC
AAGGCCAGCGACTATTCAGGGCCAGAGAGGACTCCTCCACCGCCCAATGCTCCTCGGCTCTGGTGCATCCTGGGC
GACCTGGAGAATAATCCGAGCCATTACACGCGGGCCTGGCACCTGTCCCAAAAGCGATATGCCCGCGCTCAAAAA
TCCCTAGGCGAGTACTATGTGCAACAGCGCGACTGGCCCGAGGCTCTTGGGGCTTACCAGCTCGCGACGGCCGTC
AATCGTCTAAACCCCGACTTGTGGTGTCGTCTGGGCGACATTAATCTGCGCCTGGGCCACTTTGAAGAGGCTGCC
GAGGCGTACAATCGCTCAATAGCCTGCACCAACGACATGGCTGGCGGAGAAGATGCCAGGACGTGGAGCAATTTG
GGCAGCGCTCTGTGGAGTCTATACTCGGTCAAGGCTGCCAGGGGGGAGAAGAAGGAAACGACTGCAAACACAGAC
CAAGATGGCGACCAAGACTTGACCGCCACAGAAGGACAAGAGCAGACTGACAATATCGCCGCGCTCCTGTCCCAG
TCTCTAGCCGCCTACAAAAAGGGTGCTTCCATTGCCCATGACAACTGGCGCATCTGGGACAATGTGCTCACGCTG
GCCGCCCGCGTCCAACCCGTCCCCATTGCTGACATGGTGCTCGCCTTGAAGCACATTATCCGTATCCGCCGCACC
GAGGACGCCATTGACGCCACGCTGCTCACGGCCCTGGTCCAAGACGCCGTCTTGTCGAGGGCCACGACGGAGCGC
CTCACAAGCACCGACTGCGTCTACCAGCCACCCCGCGGCTCTCCAGAGCGCCTCGTCACGCGCCTCGTCGAGGAC
GACATTGTGCCCCTCATTACTCGCCGCTCCGACCTCTGGGCCCTCGTCTCCCGTCTACGGGGCTGGCGCTACGAT
TACGCCGCCGCCCTTGACGCCTCGGAGCGTGCCTGGCGTGCTGCCGCTGGCTCCTCGGGAAGCGGCCTATTGGCC
GGCGCCGACGCGGCTGCTGCTGCCGACTGGACCATTGACGAGGCTGCCTGGTCCGACGTGGTGCAGCGCACAGAC
GAGCTCGTCTCCGCCCTGGCCAACTGGGGGCCTGATGTGCTGGGGCTGCAGTGGCGTGCCCGGGCGAGGAGTGCC
CTTCGCAGCATCATGGGTCGCGCCCGAGACCCATGGCAAGGCAGCGAGGGCTGGACAATTCTTGAGAACCACTTG
GAGCATCTCAAAGTGCACAAGTAA
Transcript >OphauB2|1044
ATGGACGATGCGTCAGTCAAGACGTCTGGTCCAAGCGCGCCTCAGGGCGTCTCTACCGACAATGACGATGCTATT
CGCCCTCTCTTAATTCTGTCAGAGAGCAGGACGGCAAAGGATATAATCCAGACCCATGTGCGCCAACTTGTCGTC
TCGGCGCCTGCTTCGCTGAAGCCGTGGTGTTTTGCCTCTGACGACGATGGCATCACCCCTCTCGACGTTGGGCTT
GCTGCTCTCGACGCTTTCCTACAGGCCAACGTTACAGGCCCGGTTCTCTCTCCTCATCTGATTGCGCGTGTCGAG
GAGCGGTTTGCTAGTGCTTGGAGGGACAACCACATTGGCAGTCAAGCCACTTTGCCCAGCCTTGGAAACACCTGC
CTCAAGCATCTTGGCGTTGATGGCGTGGCTCCTTATGCATATATACCATACCTAGAGCTGTTTTCTCTGGCCAGA
TATATATTGGTGGAGGCTGAGGGACTACTGAAACAAGGCAATGGCACATCATGGATGCGGCTGCGTCTTCATGTC
TGGCATTACAAGCTTCTTACACAGCCTAGCCTAGGTCCAGGGTCAAATTTTACCAAGAGCTCACAGTGGAGCGAT
GTGCCCACTCTGGCATCAACTATACTGGAACACATGGATCTTCTTCTGCCGCTTGTCTCTGATTACCAACCCTGG
AGTCAGCAAGAAAAAGCCCAGTTTCTAATAGAGGCGGCAAATAATTACATTCTGCTTGGTCACTATGAAAAAGCC
AAGAAGACGCTCAGAGATGCAGCACAAGTAAATGGGCTTGTCTATGCTCTATCCGGAGCTCTGGGCAAGAGGACC
AAATTCCAAGACAAGGACACCAGCCAGCTTGTAGTACTGGCTCGTGGCCGTGATGCCCAAGTGGAGGGCAAGCTT
GGAAAAGTCCAGGACGATGCTCCAGAACTTGCCAGGCCCGAGGCGCTGCAGCTAAATGACGACACTCTTCTCGAG
GATATTGACTTTGCAAAAGACGGCAACAATGGCTCCAACTCAGCTTCATTGCCTCTTGCTCTGCTTCATTTCTCC
CCAGACGAGCAGCCGCAGCTCTCTCCCCTCGACCAGATTATTCTCCTTACCGAGGCCACTCTCAAAGATGCCTTT
TCACCCGCTGATTCTTTGACTGCAGAGGAGATGTTACCCTTTGCTGCGCGCGTTCTGGCCGATAAGTCGACCAAC
TGGCAAATATTCACCCAAGCCCTACTTGTACGCTCGCGGATAGAAATCCATAGGAGCAGAACTGTTGAACGAGGC
GTGCTTCAGCTACAAGCATTAGCAGACCAGGTTATTGTCGACACATCAGCTCCACCAAAGCAATCTGTGCAGTCA
GCCGAGGCCAAATCTGCCGCTCTTTCGGCACCTACCATCAAAGTTACCGGGGCTGAGCACAGTGATGCTCATGTC
AAGAGTCAAGTAGCGTCATCGTTTTTGCCAGCAGCCAAAGCCTCGGAATCAGCTTCTGCCAATGTTCGTCTTCGC
TATATTCATGCGCTTTCTACGCCTCCCAGGTGGCATCTCGAGTCAGAGCTGGCGTATGCTTGGGCTGGCGTTGGA
TCATTGGTGTCTGCTCTTGAAATCTTTAAACGACTGCGGCTCTGGGCAGAAGTAGCCTTGTGCTTTGCCAGTGCA
GCAGCAGCAGAAGACGAGCATGGCCGGGGCAGCGGGGGCGAGGACAAGGCTAGAGCAGTTATCCGCTGGCGTCTA
TTCCATGGTACAGACGACCATGGCTTGACAAGTACTGGACCAGACGACGAAGGCATCGAGGACCTGTCACTTGTC
AAGGCCAGCGACTATTCAGGGCCAGAGAGGACTCCTCCACCGCCCAATGCTCCTCGGCTCTGGTGCATCCTGGGC
GACCTGGAGAATAATCCGAGCCATTACACGCGGGCCTGGCACCTGTCCCAAAAGCGATATGCCCGCGCTCAAAAA
TCCCTAGGCGAGTACTATGTGCAACAGCGCGACTGGCCCGAGGCTCTTGGGGCTTACCAGCTCGCGACGGCCGTC
AATCGTCTAAACCCCGACTTGTGGTGTCGTCTGGGCGACATTAATCTGCGCCTGGGCCACTTTGAAGAGGCTGCC
GAGGCGTACAATCGCTCAATAGCCTGCACCAACGACATGGCTGGCGGAGAAGATGCCAGGACGTGGAGCAATTTG
GGCAGCGCTCTGTGGAGTCTATACTCGGTCAAGGCTGCCAGGGGGGAGAAGAAGGAAACGACTGCAAACACAGAC
CAAGATGGCGACCAAGACTTGACCGCCACAGAAGGACAAGAGCAGACTGACAATATCGCCGCGCTCCTGTCCCAG
TCTCTAGCCGCCTACAAAAAGGGTGCTTCCATTGCCCATGACAACTGGCGCATCTGGGACAATGTGCTCACGCTG
GCCGCCCGCGTCCAACCCGTCCCCATTGCTGACATGGTGCTCGCCTTGAAGCACATTATCCGTATCCGCCGCACC
GAGGACGCCATTGACGCCACGCTGCTCACGGCCCTGGTCCAAGACGCCGTCTTGTCGAGGGCCACGACGGAGCGC
CTCACAAGCACCGACTGCGTCTACCAGCCACCCCGCGGCTCTCCAGAGCGCCTCGTCACGCGCCTCGTCGAGGAC
GACATTGTGCCCCTCATTACTCGCCGCTCCGACCTCTGGGCCCTCGTCTCCCGTCTACGGGGCTGGCGCTACGAT
TACGCCGCCGCCCTTGACGCCTCGGAGCGTGCCTGGCGTGCTGCCGCTGGCTCCTCGGGAAGCGGCCTATTGGCC
GGCGCCGACGCGGCTGCTGCTGCCGACTGGACCATTGACGAGGCTGCCTGGTCCGACGTGGTGCAGCGCACAGAC
GAGCTCGTCTCCGCCCTGGCCAACTGGGGGCCTGATGTGCTGGGGCTGCAGTGGCGTGCCCGGGCGAGGAGTGCC
CTTCGCAGCATCATGGGTCGCGCCCGAGACCCATGGCAAGGCAGCGAGGGCTGGACAATTCTTGAGAACCACTTG
GAGCATCTCAAAGTGCACAAGTAA
Gene >OphauB2|1044
ATGGACGATGCGTCAGTCAAGACGTCTGGTCCAAGCGCGCCTCAGGGCGTCTCTACCGACAATGACGATGCTATT
CGCCCTCTCTTAATTCTGTCAGAGAGCAGGACGGCAAAGGATATAATCCAGACCCATGTGCGCCAACTTGTCGTC
TCGGCGCCTGCTTCGCTGAAGCCGTGGTGTTTTGCCTCTGACGACGATGGCATCACCCCTCTCGACGTTGGGCTT
GCTGCTCTCGACGCTTTCCTACAGGCCAACGTTACAGGCCCGGTTCTCTCTCCTCATCTGATTGCGCGTGTCGAG
GAGCGGTTTGCTAGTGCTTGGAGGGACAACCACATTGGCAGTCAAGCCACTTTGCCCAGCCTTGGAAACACCTGC
CTCAAGCATCTTGGCGTTGATGGCGTGGCTCCTTATGCATATATACCATACCTAGAGCTGTTTTCTCTGGCCAGA
TATATATTGGTGGAGGCTGAGGGACTACTGAAACAAGGCAATGGCACATCATGGATGCGGCTGCGTCTTCATGTC
TGGCATTACAAGCTTCTTACACAGCCTAGCCTAGGTCCAGGGTCAAATTTTACCAAGAGCTCACAGTGGAGCGAT
GTGCCCACTCTGGCATCAACTATACTGGAACACATGGATCTTCTTCTGCCGCTTGTCTCTGATTACCAACCCTGG
AGTCAGCAAGAAAAAGCCCAGTTTCTAATAGAGGCGGCAAATAATTACATTCTGCTTGGTCACTATGAAAAAGCC
AAGAAGACGCTCAGAGATGCAGCACAAGTAAATGGGCTTGTCTATGCTCTATCCGGAGCTCTGGGCAAGAGGACC
AAATTCCAAGACAAGGACACCAGCCAGCTTGTAGTACTGGCTCGTGGCCGTGATGCCCAAGTGGAGGGCAAGCTT
GGAAAAGTCCAGGACGATGCTCCAGAACTTGCCAGGCCCGAGGCGCTGCAGCTAAATGACGACACTCTTCTCGAG
GATATTGACTTTGCAAAAGACGGCAACAATGGCTCCAACTCAGCTTCATTGCCTCTTGCTCTGCTTCATTTCTCC
CCAGACGAGCAGCCGCAGCTCTCTCCCCTCGACCAGATTATTCTCCTTACCGAGGCCACTCTCAAAGATGCCTTT
TCACCCGCTGATTCTTTGACTGCAGAGGAGATGTTACCCTTTGCTGCGCGCGTTCTGGCCGATAAGTCGACCAAC
TGGCAAATATTCACCCAAGCCCTACTTGTACGCTCGCGGATAGAAATCCATAGGAGCAGAACTGTTGAACGAGGC
GTGCTTCAGCTACAAGCATTAGCAGACCAGGTTATTGTCGACACATCAGCTCCACCAAAGCAATCTGTGCAGTCA
GCCGAGGCCAAATCTGCCGCTCTTTCGGCACCTACCATCAAAGTTACCGGGGCTGAGCACAGTGATGCTCATGTC
AAGAGTCAAGTAGCGTCATCGTTTTTGCCAGCAGCCAAAGCCTCGGAATCAGCTTCTGCCAATGTTCGTCTTCGC
TATATTCATGCGCTTTCTACGCCTCCCAGGTGGCATCTCGAGTCAGAGCTGGCGTATGCTTGGGCTGGCGTTGGA
TCATTGGTGTCTGCTCTTGAAATCTTTAAACGACTGCGGCTCTGGGCAGAAGTAGCCTTGTGCTTTGCCAGTGCA
GCAGCAGCAGAAGACGAGCATGGCCGGGGCAGCGGGGGCGAGGACAAGGCTAGAGCAGTTATCCGCTGGCGTCTA
TTCCATGGTACAGACGACCATGGCTTGACAAGTACTGGACCAGACGACGAAGGCATCGAGGACCTGTCACTTGTC
AAGGCCAGCGACTATTCAGGGCCAGAGAGGACTCCTCCACCGCCCAATGCTCCTCGGCTCTGGTGCATCCTGGGC
GACCTGGAGAATAATCCGAGCCATTACACGCGGGCCTGGCACCTGTCCCAAAAGCGATATGCCCGCGCTCAAAAA
TCCCTAGGCGAGTACTATGTGCAACAGCGCGACTGGCCCGAGGCTCTTGGGGCTTACCAGCTCGCGACGGCCGTC
AATCGTCTAAACCCCGACTTGTGGTGTCGTCTGGGCGACATTAATCTGCGCCTGGGCCACTTTGAAGAGGCTGCC
GAGGCGTACAATCGCTCAATAGCCTGCACCAACGACATGGCTGGCGGAGAAGATGCCAGGACGTGGAGCAATTTG
GGCAGCGCTCTGTGGAGTCTATACTCGGTCAAGGCTGCCAGGGGGGAGAAGAAGGAAACGACTGCAAACACAGAC
CAAGATGGCGACCAAGACTTGACCGCCACAGAAGGACAAGAGCAGACTGACAATATCGCCGCGCTCCTGTCCCAG
TCTCTAGCCGCCTACAAAAAGGGTGCTTCCATTGCCCATGACAACTGGCGCATCTGGGACAATGTGCTCACGCTG
GCCGCCCGCGTCCAACCCGTCCCCATTGCTGACATGGTGCTCGCCTTGAAGCACATTATCCGTATCCGCCGCACC
GAGGACGCCATTGACGCCACGCTGCTCACGGCCCTGGTCCAAGACGCCGTCTTGTCGAGGGCCACGACGGAGCGC
CTCACAAGCACCGACTGCGTCTACCAGCCACCCCGCGGCTCTCCAGAGCGCCTCGTCACGCGCCTCGTCGAGGAC
GACATTGTGCCCCTCATTACTCGCCGCTCCGACCTCTGGGCCCTCGTCTCCCGTCTACGGGGCTGGCGCTACGAT
TACGCCGCCGCCCTTGACGCCTCGGAGCGTGCCTGGCGTGCTGCCGCTGGCTCCTCGGGAAGCGGCCTATTGGCC
GGCGCCGACGCGGCTGCTGCTGCCGACTGGACCATTGACGAGGCTGCCTGGTCCGACGTGGTGCAGCGCACAGAC
GAGCTCGTCTCCGCCCTGGCCAACTGGGGGCCTGATGTGCTGGGGCTGCAGTGGCGTGCCCGGGCGAGGAGTGCC
CTTCGCAGCATCATGGGTCGCGCCCGAGACCCATGGCAAGGCAGCGAGGGCTGGACAATTCTTGAGAACCACTTG
GAGCATCTCAAAGTGCACAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail