Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1042
Gene name
LocationContig_123:43403..44059
Strand-
Gene length (bp)656
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 8.8E-14 88 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 62 193 8.0E-59
sp|Q8S904|MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=MFDX2 PE=2 SV=1 80 193 9.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 61 193 1.0E-40
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 81 189 1.0E-37
sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 81 189 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 62 193 8.0E-59
sp|Q8S904|MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=MFDX2 PE=2 SV=1 80 193 9.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 61 193 1.0E-40
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 81 189 1.0E-37
sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 81 189 4.0E-37
sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 81 189 5.0E-37
sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 81 189 8.0E-37
sp|Q9AKC4|FER2_RICTY 2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fdxB PE=3 SV=1 80 194 2.0E-36
sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 80 189 3.0E-36
sp|Q05B51|ADXL_BOVIN Adrenodoxin-like protein, mitochondrial OS=Bos taurus GN=FDX1L PE=2 SV=1 34 188 2.0E-31
sp|Q1RJ69|FER2_RICBR 2Fe-2S ferredoxin OS=Rickettsia bellii (strain RML369-C) GN=fdxB PE=3 SV=1 80 189 8.0E-31
sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 59 188 2.0E-28
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=etp1 PE=1 SV=2 13 189 3.0E-28
sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 64 188 1.0E-27
sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 84 188 3.0E-27
sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=1 SV=1 59 188 1.0E-26
sp|P10109|ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens GN=FDX1 PE=1 SV=1 81 191 8.0E-26
sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 84 188 9.0E-26
sp|P46656|ADX_MOUSE Adrenodoxin, mitochondrial OS=Mus musculus GN=Fdx1 PE=1 SV=1 81 191 4.0E-25
sp|P24483|ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus GN=Fdx1 PE=2 SV=1 81 191 5.0E-25
sp|P29330|ADX_SHEEP Adrenodoxin OS=Ovis aries GN=FDX1 PE=1 SV=2 81 191 5.0E-25
sp|P00258|ADX_PIG Adrenodoxin, mitochondrial OS=Sus scrofa GN=FDX1 PE=1 SV=2 81 182 1.0E-24
sp|P00257|ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus GN=FDX1 PE=1 SV=2 81 182 1.0E-24
sp|P13216|ADX_CHICK Adrenodoxin, mitochondrial (Fragment) OS=Gallus gallus GN=FDX1 PE=1 SV=1 81 191 2.0E-24
sp|Q8SV19|ADRX_ENCCU Adrenodoxin homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0600 PE=3 SV=1 101 194 3.0E-23
sp|P80306|FER6_RHOCA Ferredoxin-6 OS=Rhodobacter capsulatus GN=fdxE PE=1 SV=2 84 182 5.0E-18
sp|P0A9R6|FER_SHIFL 2Fe-2S ferredoxin OS=Shigella flexneri GN=fdx PE=3 SV=2 101 187 1.0E-17
sp|P0A9R4|FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) GN=fdx PE=1 SV=2 101 187 1.0E-17
sp|P0A9R5|FER_ECO57 2Fe-2S ferredoxin OS=Escherichia coli O157:H7 GN=fdx PE=3 SV=2 101 187 1.0E-17
sp|P37098|FER2_CAUCR 2Fe-2S ferredoxin OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fdxB PE=3 SV=1 84 182 3.0E-17
sp|P44428|FER_HAEIN 2Fe-2S ferredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fdx PE=3 SV=2 99 187 6.0E-17
sp|P00259|PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida GN=camB PE=1 SV=3 84 182 2.0E-16
sp|Q51383|FER_PSEAE 2Fe-2S ferredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdx PE=3 SV=2 96 187 1.0E-15
sp|P43493|THCC_RHOER Rhodocoxin OS=Rhodococcus erythropolis GN=thcC PE=1 SV=2 84 182 3.0E-14
sp|P33007|TERPB_PSESP Terpredoxin OS=Pseudomonas sp. GN=terPB PE=1 SV=2 84 182 2.0E-13
sp|O51882|FER_BUCAP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fdx PE=3 SV=1 96 167 6.0E-13
sp|P57661|FER_BUCAI 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fdx PE=3 SV=1 101 187 2.0E-11
sp|Q89A15|FER_BUCBP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fdx PE=3 SV=1 96 187 7.0E-11
sp|D5IGG4|CARAC_SPHSX Ferredoxin CarAc OS=Sphingomonas sp. GN=carAc PE=1 SV=1 81 182 7.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0051540 metal cluster binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1042
MPLSRIATPARLVRLAALGHSRGLSLPSLAQSPTSRLVSQYQPKTRWTSIPRMAATRFSRCFTTTTCRHHGNIEP
PKPGQELYVTFIDKDGEEHKFAVAEGDNLLDIAQANDLEMEGACGGSCACSTCHVIVVDDKFYDKMPEPDDDEND
MLDLAFGLTETSRLGCQVKMTKELDGLVVKLPSMTRNLQASDFQ*
Coding >OphauB2|1042
ATGCCCCTCTCGAGGATAGCCACCCCAGCGCGTCTGGTGCGTCTGGCGGCTCTGGGTCACAGTCGCGGCTTGTCG
CTGCCAAGCCTCGCACAGTCCCCGACGTCGCGCCTTGTGTCACAATACCAACCCAAGACAAGATGGACGTCAATA
CCGCGCATGGCGGCGACAAGATTCAGCCGCTGCTTCACCACGACGACTTGTCGGCACCACGGGAATATCGAGCCG
CCCAAGCCTGGCCAAGAGCTCTACGTCACCTTCATCGACAAAGACGGCGAGGAGCACAAGTTTGCCGTTGCAGAG
GGAGACAATCTGCTCGATATTGCCCAGGCGAATGATCTCGAAATGGAGGGCGCATGCGGTGGCTCTTGTGCCTGC
TCGACTTGTCACGTCATTGTTGTCGATGACAAGTTTTACGACAAGATGCCCGAGCCAGACGACGATGAGAACGAC
ATGCTAGACTTGGCTTTTGGCCTCACAGAAACGAGTCGCCTCGGCTGCCAGGTCAAGATGACTAAAGAACTTGAT
GGCCTCGTAGTCAAGCTACCGTCCATGACGCGCAACTTGCAAGCCAGCGACTTTCAATAA
Transcript >OphauB2|1042
ATGCCCCTCTCGAGGATAGCCACCCCAGCGCGTCTGGTGCGTCTGGCGGCTCTGGGTCACAGTCGCGGCTTGTCG
CTGCCAAGCCTCGCACAGTCCCCGACGTCGCGCCTTGTGTCACAATACCAACCCAAGACAAGATGGACGTCAATA
CCGCGCATGGCGGCGACAAGATTCAGCCGCTGCTTCACCACGACGACTTGTCGGCACCACGGGAATATCGAGCCG
CCCAAGCCTGGCCAAGAGCTCTACGTCACCTTCATCGACAAAGACGGCGAGGAGCACAAGTTTGCCGTTGCAGAG
GGAGACAATCTGCTCGATATTGCCCAGGCGAATGATCTCGAAATGGAGGGCGCATGCGGTGGCTCTTGTGCCTGC
TCGACTTGTCACGTCATTGTTGTCGATGACAAGTTTTACGACAAGATGCCCGAGCCAGACGACGATGAGAACGAC
ATGCTAGACTTGGCTTTTGGCCTCACAGAAACGAGTCGCCTCGGCTGCCAGGTCAAGATGACTAAAGAACTTGAT
GGCCTCGTAGTCAAGCTACCGTCCATGACGCGCAACTTGCAAGCCAGCGACTTTCAATAA
Gene >OphauB2|1042
ATGCCCCTCTCGAGGATAGCCACCCCAGCGCGTCTGGTGCGTCTGGCGGCTCTGGGTCACAGTCGCGGCTTGTCG
CTGCCAAGCCTCGCACAGTCCCCGACGTCGCGCCTTGTGTCACAATACCAACCCAAGACAAGATGGACGTCAATA
CCGCGCATGGCGGCGACAAGATTCAGCCGCTGCTTCACCACGACGACTTGTCGGCACCACGGGAATATCGAGCCG
CCCAAGCCTGGCCAAGAGTGAGCAAGCAATCATCAAGAGCCATTGCGCTCTCCTTGACCATTCTTGCCACTGACA
CCACCACTTGCAGGCTCTACGTCACCTTCATCGACAAAGACGGCGAGGAGCACAAGTTTGCCGTTGCAGAGGGAG
ACAATCTGCTCGATATTGCCCAGGCGAATGATCTCGAAATGGAGGGCGCATGCGGTGGCTCTTGTGCCTGCTCGA
CTTGTCACGTCATTGTTGTCGATGACAAGTTTTACGACAAGATGCCCGAGCCAGACGACGATGAGAACGACATGC
TAGACTTGGCTTTTGGCCTCACAGAAACGAGTCGCCTCGGCTGCCAGGTCAAGATGACTAAAGAACTTGATGGCC
TCGTAGTCAAGCTACCGTCCATGACGCGCAACTTGCAAGCCAGCGACTTTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail