Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|103
Gene name
LocationContig_1:266660..267866
Strand-
Gene length (bp)1206
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e 7.7E-23 154 284

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74464|RM22_SCHPO 54S ribosomal protein L22, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl22 PE=3 SV=1 152 322 7.0E-11
sp|P53881|RM22_YEAST 54S ribosomal protein L22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL22 PE=1 SV=2 131 323 1.0E-07
sp|A8LM59|RL22_DINSH 50S ribosomal protein L22 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplV PE=3 SV=1 145 285 7.0E-06

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5810
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6354
Ophiocordyceps australis map64 (Brazil) OphauB2|103 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00901
Ophiocordyceps camponoti-rufipedis Ophun1|5144
Ophiocordyceps kimflemingae Ophio5|730

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|103
MSPSPCSHASSPFYTQHRSISFGALWKKWRGKKDEGVAAELDDPQIRKKFLQKTSERGSIASDNIFNEEIKSASD
DRDSADLDNKSSKLSEEMQARKHFSNVPRTHENTAIVLDPDPASRIRWLRKKVIQMVRNPNSVTPEQRIRALERE
CTHSSHFMATSTKKLCMLSRQIAGMPVDKAIDQMRWSKKKYSKEILYYLEEARDLAIAKHGMGLGKVNGELFKEP
RKILTKDGKWISISDPTRIYIAQSWVGRGGYLLRRPDRKGRGRIGTISRPSTKITFILKEEKTRIRECAERDAKK
AAKGPWVHHPNRSLIGQRPYYSW*
Coding >OphauB2|103
ATGAGTCCTTCGCCGTGCTCACACGCCTCATCACCCTTTTATACCCAACACCGCTCCATCTCATTCGGCGCTCTC
TGGAAGAAATGGAGGGGCAAAAAGGACGAGGGCGTAGCAGCCGAGCTCGACGACCCCCAAATACGCAAAAAATTC
CTCCAAAAGACGTCGGAGCGCGGCTCCATCGCCTCTGACAACATCTTCAACGAGGAAATCAAGTCGGCTTCAGAT
GACCGAGACTCTGCCGACCTTGACAACAAGTCTTCCAAACTCTCTGAGGAGATGCAAGCCCGCAAGCACTTTTCC
AACGTCCCCAGGACTCACGAAAACACGGCCATTGTGCTTGACCCCGATCCCGCCTCCCGTATCCGCTGGCTTCGC
AAAAAGGTGATTCAAATGGTTCGCAACCCAAACTCTGTTACTCCCGAGCAGCGGATCCGCGCCTTGGAGCGCGAA
TGTACCCACTCGAGCCACTTCATGGCAACTTCGACCAAGAAACTCTGCATGCTCTCCCGCCAGATTGCCGGCATG
CCCGTTGACAAGGCCATTGACCAGATGCGCTGGTCAAAGAAAAAGTATTCCAAGGAAATTCTCTACTATCTGGAA
GAAGCTCGCGATCTCGCCATTGCCAAACACGGCATGGGACTGGGCAAAGTCAATGGCGAGCTCTTCAAGGAACCT
CGCAAAATCTTGACAAAAGATGGCAAATGGATCAGCATTTCTGACCCTACCCGCATCTACATTGCCCAGTCGTGG
GTCGGCAGGGGCGGATACCTGCTTCGCCGTCCAGATCGCAAGGGCCGTGGTAGAATAGGCACTATTTCACGTCCA
AGCACAAAAATCACCTTTATCCTCAAAGAGGAAAAAACAAGGATACGCGAGTGTGCAGAGCGCGATGCGAAAAAG
GCTGCAAAGGGCCCATGGGTCCATCATCCCAACCGCTCCCTCATTGGCCAGCGGCCCTATTACTCATGGTGA
Transcript >OphauB2|103
ATGAGTCCTTCGCCGTGCTCACACGCCTCATCACCCTTTTATACCCAACACCGCTCCATCTCATTCGGCGCTCTC
TGGAAGAAATGGAGGGGCAAAAAGGACGAGGGCGTAGCAGCCGAGCTCGACGACCCCCAAATACGCAAAAAATTC
CTCCAAAAGACGTCGGAGCGCGGCTCCATCGCCTCTGACAACATCTTCAACGAGGAAATCAAGTCGGCTTCAGAT
GACCGAGACTCTGCCGACCTTGACAACAAGTCTTCCAAACTCTCTGAGGAGATGCAAGCCCGCAAGCACTTTTCC
AACGTCCCCAGGACTCACGAAAACACGGCCATTGTGCTTGACCCCGATCCCGCCTCCCGTATCCGCTGGCTTCGC
AAAAAGGTGATTCAAATGGTTCGCAACCCAAACTCTGTTACTCCCGAGCAGCGGATCCGCGCCTTGGAGCGCGAA
TGTACCCACTCGAGCCACTTCATGGCAACTTCGACCAAGAAACTCTGCATGCTCTCCCGCCAGATTGCCGGCATG
CCCGTTGACAAGGCCATTGACCAGATGCGCTGGTCAAAGAAAAAGTATTCCAAGGAAATTCTCTACTATCTGGAA
GAAGCTCGCGATCTCGCCATTGCCAAACACGGCATGGGACTGGGCAAAGTCAATGGCGAGCTCTTCAAGGAACCT
CGCAAAATCTTGACAAAAGATGGCAAATGGATCAGCATTTCTGACCCTACCCGCATCTACATTGCCCAGTCGTGG
GTCGGCAGGGGCGGATACCTGCTTCGCCGTCCAGATCGCAAGGGCCGTGGTAGAATAGGCACTATTTCACGTCCA
AGCACAAAAATCACCTTTATCCTCAAAGAGGAAAAAACAAGGATACGCGAGTGTGCAGAGCGCGATGCGAAAAAG
GCTGCAAAGGGCCCATGGGTCCATCATCCCAACCGCTCCCTCATTGGCCAGCGGCCCTATTACTCATGGTGA
Gene >OphauB2|103
ATGAGTGTCCGTTTTGCCGCGCGCCGCCTAGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCACACACACACAAAAAAAAAGAAGCATCCCACGCTTAC
ACCACCCTAGGTCCTTCGCCGTGCTCACACGCCTCATCACCCTTTTATACCCAACACCGCTCCATCTCATTCGGC
GCTCTCTGGAAGAAATGGAGGGGCAAAAAGGACGAGGGCGTAGCAGCCGAGCTCGACGACCCCCAAATACGCAAA
AAATTCCTCCAAAAGACGTCGGAGCGCGGCTCCATCGCCTCTGACAACATCTTCAACGAGGAAATCAAGTCGGCT
TCAGATGACCGAGACTCTGCCGACCTTGACAACAAGTCTTCCAAACTCTCTGAGGAGATGCAAGCCCGCAAGCAC
TTTTCCAACGTCCCCAGGACTCACGAAAACACGGCCATTGTGCTTGACCCCGATCCCGCCTCCCGTATCCGCTGG
CTTCGCAAAAAGGTGATTCAAATGGTTCGCAACCCAAACTCTGTTACTCCCGAGCAGCGGATCCGCGCCTTGGAG
CGCGAATGTACCCACTCGAGCCACTTCATGGCAACTTCGACCAAGAAACTCTGCATGCTCTCCCGCCAGATTGCC
GGCATGCCCGTTGACAAGGCCATTGACCAGATGCGCTGGTCAAAGAAAAAGTATTCCAAGGAAATTCTCTACTAT
CTGGAAGAAGCTCGCGATCTCGCCATTGCCAAACACGGCATGGGACTGGGCAAAGTCAATGGCGAGCTCTTCAAG
GAACCTCGCAAAATCTTGACAAAAGATGGCAAATGGATCAGCATTTCTGACCCTACCCGCATCTACATTGCCCAG
TCGTGGGTCGGCAGGGGCGGATACCTGCTTCGCCGTCCAGATCGCAAGGGCCGTGGTAGAATAGGCACTATTTCA
CGTCCAAGCACAAGTGCGTACCCAGACCCTTGTATCCATTTAGTCTCAGACATGCTGCCCTAGCCACCATACTCA
CTGACCCGTCTCACAGAAATCACCTTTATCCTCAAAGAGGAAAAAACAAGGATACGCGAGTGTGCAGAGCGCGAT
GCGAAAAAGGCTGCAAAGGGCCCATGGGTCCATCATCCCAACCGCTCCCTCATTGGCCAGCGGCCCTATTACTCA
TGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail