Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1028
Gene name
LocationContig_123:10592..13283
Strand-
Gene length (bp)2691
Transcript length (bp)2634
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 649 875 2.0E-30
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 616 870 5.0E-24
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 644 873 7.0E-24
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 618 815 2.0E-21
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 620 815 3.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 649 875 2.0E-30
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 616 870 5.0E-24
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 644 873 7.0E-24
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 618 815 2.0E-21
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 620 815 3.0E-21
sp|Q8R2Y3|DOLK_MOUSE Dolichol kinase OS=Mus musculus GN=Dolk PE=1 SV=1 608 815 2.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 147 166 19
2 181 203 22
3 331 353 22
4 363 385 22
5 529 551 22
6 621 643 22
7 664 686 22
8 721 743 22
9 764 786 22
10 801 823 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1028
MPEHSAADSSPHDSELDALPLSRSPHPYHHHSFDLQQPSESIAPNGHYAAAHTGALQPSQTAFPALSKESSPVSD
SGTEADDEHFLKGLPAPKAKLHKGLRGRTETSSDISTPIASPGILEHQQAHVVAKQDVDRQRQSDSLRRTKALVR
RLTETALVFSLALMVATNRRASLVFKLWRKDIISLTLIYAALLLLYPLRVVIWAYRKSNPSQRFPFKLPSNFDPA
PLLYPPAITILVSTLVSVDNAAALLPNIILSISSIPRPLIPAISSTNAYDSLHWALSCLPLIWPSSALQNAPQPT
LRPNTVPVEVAVLLYPLHQTLCVILHHLTTTSLLAAELQLLSISLISLLVLAFSPQMQLLKALLWVGGLGTLILC
SAVIRRGIALARVPKWRFRRAAGHRLRRWSIMRRLSSWHKTRGDIAGPVVHDNLLDTASSAADDDESSMNGDSSW
ARPIDSQLGSIAERGAPAASSDQDADSSMTARRHSIANLRGLPRRRPTHTPSGRRKRTTSISMRPFLKMTQEQAN
VKKWLYALYVYSSMLAVILLGVRASIQFHALDGREPIGWALGYMFGDWSWFRFQVVSAHLERWICLPARAKASDT
KECHMGWVQHLRHDEFGEANTRLLLSGYWLLVLTLGLIVVFRLKDKYEVDTRRKVFHFTMVGMLLPGTFVDPAFA
ALALALVLAVFLTLDLLRASQLPPLSKPIASFLAPYVDGRDFRGPVVISHIFLLIGCAIPLWLALAALPPTGNGP
WAGWELATRDVSMVAGVVCVGLGDAAASLIGRRYGHRKWFWGGGKSLEGSVAFAFAVFAGLIAAAAWLRVGGWPI
SDGEAKTSMLMTASKAGVCATMSSLVEAVLTGGNDNVIVPVILWTCVKSLGV*
Coding >OphauB2|1028
ATGCCAGAGCATTCAGCCGCCGACTCGTCTCCCCATGACTCGGAGCTGGACGCTCTTCCACTGAGCCGATCCCCT
CATCCATATCACCACCACAGCTTTGACCTGCAGCAGCCGTCTGAGAGCATCGCGCCCAATGGCCATTACGCCGCG
GCGCACACTGGCGCCCTGCAGCCATCTCAGACTGCTTTCCCAGCCTTGTCCAAGGAATCCTCTCCCGTCAGCGAT
AGCGGCACTGAAGCCGACGACGAGCATTTCCTCAAGGGACTTCCGGCGCCAAAAGCTAAGCTACACAAGGGTCTT
CGTGGGCGCACCGAAACTTCGTCGGACATCTCCACTCCTATAGCCTCGCCCGGCATTCTTGAACATCAACAAGCC
CATGTCGTCGCAAAACAAGACGTCGATAGACAACGCCAGTCAGACAGCTTGCGCCGAACGAAAGCACTTGTGCGT
CGCCTGACGGAAACGGCCCTCGTTTTTTCCCTCGCTCTCATGGTGGCAACAAATCGTCGAGCATCACTGGTTTTC
AAGCTTTGGCGCAAAGATATCATATCTTTAACCCTTATTTACGCTGCTTTGCTCCTGTTGTATCCGCTGCGCGTC
GTAATATGGGCATATCGAAAAAGCAACCCCTCCCAACGCTTTCCCTTCAAACTTCCCTCCAACTTTGATCCCGCT
CCACTCCTCTACCCACCCGCTATAACCATACTTGTGTCAACCCTAGTTTCAGTCGACAATGCGGCTGCTCTTTTG
CCCAACATTATCCTGAGCATAAGCTCGATTCCTCGACCGCTGATACCCGCCATTTCCTCTACAAACGCCTACGAT
TCGTTGCATTGGGCTCTCTCGTGTCTTCCTCTGATATGGCCATCTTCAGCATTACAAAATGCACCTCAGCCTACA
CTACGGCCGAATACAGTGCCCGTCGAAGTTGCAGTTCTACTGTATCCCCTTCATCAGACACTATGTGTCATACTG
CATCATCTTACTACTACAAGCCTCCTGGCTGCTGAGCTTCAGCTGCTCTCTATTTCTCTCATATCGCTGCTTGTA
TTGGCCTTTTCTCCGCAGATGCAGCTATTGAAAGCATTGCTATGGGTAGGAGGATTAGGCACCTTGATACTCTGC
AGTGCTGTCATCCGACGGGGAATCGCATTGGCGCGAGTGCCCAAGTGGCGTTTTCGGAGAGCTGCGGGCCATCGA
CTGAGGCGCTGGAGCATCATGCGTCGGCTTTCGTCATGGCACAAGACCAGAGGGGACATTGCAGGGCCAGTTGTC
CATGACAATCTGCTCGACACAGCTTCGTCGGCCGCTGATGACGATGAATCCTCCATGAATGGTGATTCTTCTTGG
GCACGCCCCATAGACTCCCAACTGGGCTCTATTGCTGAGCGTGGCGCGCCAGCTGCGTCTTCAGACCAGGACGCA
GACTCAAGCATGACTGCGCGGCGCCATAGTATAGCGAATCTAAGAGGTTTGCCACGCAGACGCCCAACACACACC
CCGTCAGGGAGAAGAAAAAGGACAACATCGATTTCGATGCGGCCCTTTCTCAAAATGACGCAAGAGCAGGCGAAT
GTAAAGAAATGGCTGTATGCGCTCTACGTCTATAGCTCCATGTTGGCCGTCATCTTGTTGGGTGTCCGTGCCTCT
ATCCAATTCCATGCTCTTGACGGCAGGGAGCCAATTGGATGGGCCCTTGGATACATGTTTGGCGACTGGTCTTGG
TTTCGCTTCCAGGTGGTCAGTGCCCACCTCGAGCGCTGGATTTGCCTGCCAGCACGAGCCAAGGCGTCGGATACT
AAAGAGTGCCATATGGGCTGGGTGCAGCATCTTCGCCACGACGAATTTGGCGAGGCAAACACGAGGCTGCTACTC
AGTGGCTACTGGCTTCTTGTCCTCACTTTGGGCCTCATCGTCGTCTTCAGACTCAAGGACAAGTATGAAGTGGAT
ACAAGGCGCAAGGTCTTTCATTTCACCATGGTGGGCATGCTTCTGCCGGGCACCTTTGTCGATCCTGCCTTTGCC
GCATTGGCATTGGCTCTTGTCCTTGCCGTCTTTCTGACTCTTGACCTCTTGCGGGCAAGTCAGTTGCCACCTCTG
TCGAAGCCCATTGCCTCCTTTCTGGCGCCCTACGTGGATGGTAGAGACTTTCGCGGGCCCGTTGTTATTTCCCAC
ATCTTCCTTCTCATAGGATGTGCTATTCCTCTTTGGCTAGCTCTGGCTGCTCTTCCACCAACGGGAAATGGCCCC
TGGGCGGGTTGGGAGTTGGCCACTCGCGATGTCAGCATGGTCGCTGGTGTCGTTTGCGTTGGTCTTGGAGACGCA
GCCGCCTCCTTGATTGGCCGGCGCTATGGTCACCGCAAGTGGTTTTGGGGCGGTGGCAAGAGCCTTGAAGGCAGC
GTTGCCTTTGCCTTTGCCGTCTTTGCTGGACTAATAGCTGCTGCAGCTTGGTTGCGCGTGGGTGGCTGGCCTATA
TCAGATGGAGAGGCAAAGACGAGCATGCTGATGACGGCTAGTAAAGCTGGCGTCTGCGCCACAATGAGCAGCCTA
GTTGAGGCAGTGCTGACAGGCGGCAACGACAACGTCATTGTGCCCGTCATTTTGTGGACATGTGTCAAGAGCTTG
GGAGTCTAG
Transcript >OphauB2|1028
ATGCCAGAGCATTCAGCCGCCGACTCGTCTCCCCATGACTCGGAGCTGGACGCTCTTCCACTGAGCCGATCCCCT
CATCCATATCACCACCACAGCTTTGACCTGCAGCAGCCGTCTGAGAGCATCGCGCCCAATGGCCATTACGCCGCG
GCGCACACTGGCGCCCTGCAGCCATCTCAGACTGCTTTCCCAGCCTTGTCCAAGGAATCCTCTCCCGTCAGCGAT
AGCGGCACTGAAGCCGACGACGAGCATTTCCTCAAGGGACTTCCGGCGCCAAAAGCTAAGCTACACAAGGGTCTT
CGTGGGCGCACCGAAACTTCGTCGGACATCTCCACTCCTATAGCCTCGCCCGGCATTCTTGAACATCAACAAGCC
CATGTCGTCGCAAAACAAGACGTCGATAGACAACGCCAGTCAGACAGCTTGCGCCGAACGAAAGCACTTGTGCGT
CGCCTGACGGAAACGGCCCTCGTTTTTTCCCTCGCTCTCATGGTGGCAACAAATCGTCGAGCATCACTGGTTTTC
AAGCTTTGGCGCAAAGATATCATATCTTTAACCCTTATTTACGCTGCTTTGCTCCTGTTGTATCCGCTGCGCGTC
GTAATATGGGCATATCGAAAAAGCAACCCCTCCCAACGCTTTCCCTTCAAACTTCCCTCCAACTTTGATCCCGCT
CCACTCCTCTACCCACCCGCTATAACCATACTTGTGTCAACCCTAGTTTCAGTCGACAATGCGGCTGCTCTTTTG
CCCAACATTATCCTGAGCATAAGCTCGATTCCTCGACCGCTGATACCCGCCATTTCCTCTACAAACGCCTACGAT
TCGTTGCATTGGGCTCTCTCGTGTCTTCCTCTGATATGGCCATCTTCAGCATTACAAAATGCACCTCAGCCTACA
CTACGGCCGAATACAGTGCCCGTCGAAGTTGCAGTTCTACTGTATCCCCTTCATCAGACACTATGTGTCATACTG
CATCATCTTACTACTACAAGCCTCCTGGCTGCTGAGCTTCAGCTGCTCTCTATTTCTCTCATATCGCTGCTTGTA
TTGGCCTTTTCTCCGCAGATGCAGCTATTGAAAGCATTGCTATGGGTAGGAGGATTAGGCACCTTGATACTCTGC
AGTGCTGTCATCCGACGGGGAATCGCATTGGCGCGAGTGCCCAAGTGGCGTTTTCGGAGAGCTGCGGGCCATCGA
CTGAGGCGCTGGAGCATCATGCGTCGGCTTTCGTCATGGCACAAGACCAGAGGGGACATTGCAGGGCCAGTTGTC
CATGACAATCTGCTCGACACAGCTTCGTCGGCCGCTGATGACGATGAATCCTCCATGAATGGTGATTCTTCTTGG
GCACGCCCCATAGACTCCCAACTGGGCTCTATTGCTGAGCGTGGCGCGCCAGCTGCGTCTTCAGACCAGGACGCA
GACTCAAGCATGACTGCGCGGCGCCATAGTATAGCGAATCTAAGAGGTTTGCCACGCAGACGCCCAACACACACC
CCGTCAGGGAGAAGAAAAAGGACAACATCGATTTCGATGCGGCCCTTTCTCAAAATGACGCAAGAGCAGGCGAAT
GTAAAGAAATGGCTGTATGCGCTCTACGTCTATAGCTCCATGTTGGCCGTCATCTTGTTGGGTGTCCGTGCCTCT
ATCCAATTCCATGCTCTTGACGGCAGGGAGCCAATTGGATGGGCCCTTGGATACATGTTTGGCGACTGGTCTTGG
TTTCGCTTCCAGGTGGTCAGTGCCCACCTCGAGCGCTGGATTTGCCTGCCAGCACGAGCCAAGGCGTCGGATACT
AAAGAGTGCCATATGGGCTGGGTGCAGCATCTTCGCCACGACGAATTTGGCGAGGCAAACACGAGGCTGCTACTC
AGTGGCTACTGGCTTCTTGTCCTCACTTTGGGCCTCATCGTCGTCTTCAGACTCAAGGACAAGTATGAAGTGGAT
ACAAGGCGCAAGGTCTTTCATTTCACCATGGTGGGCATGCTTCTGCCGGGCACCTTTGTCGATCCTGCCTTTGCC
GCATTGGCATTGGCTCTTGTCCTTGCCGTCTTTCTGACTCTTGACCTCTTGCGGGCAAGTCAGTTGCCACCTCTG
TCGAAGCCCATTGCCTCCTTTCTGGCGCCCTACGTGGATGGTAGAGACTTTCGCGGGCCCGTTGTTATTTCCCAC
ATCTTCCTTCTCATAGGATGTGCTATTCCTCTTTGGCTAGCTCTGGCTGCTCTTCCACCAACGGGAAATGGCCCC
TGGGCGGGTTGGGAGTTGGCCACTCGCGATGTCAGCATGGTCGCTGGTGTCGTTTGCGTTGGTCTTGGAGACGCA
GCCGCCTCCTTGATTGGCCGGCGCTATGGTCACCGCAAGTGGTTTTGGGGCGGTGGCAAGAGCCTTGAAGGCAGC
GTTGCCTTTGCCTTTGCCGTCTTTGCTGGACTAATAGCTGCTGCAGCTTGGTTGCGCGTGGGTGGCTGGCCTATA
TCAGATGGAGAGGCAAAGACGAGCATGCTGATGACGGCTAGTAAAGCTGGCGTCTGCGCCACAATGAGCAGCCTA
GTTGAGGCAGTGCTGACAGGCGGCAACGACAACGTCATTGTGCCCGTCATTTTGTGGACATGTGTCAAGAGCTTG
GGAGTCTAG
Gene >OphauB2|1028
ATGCCAGAGCATTCAGCCGCCGACTCGTCTCCCCATGACTCGGAGCTGGACGCTCTTCCACTGAGCCGATCCCCT
CATCCATATCACCACCACAGCTTTGACCTGCAGCAGCCGTCTGAGAGCATCGCGCCCAATGGCCATTACGCCGCG
GCGCACACTGGCGCCCTGCAGCCATCTCAGACTGCTTTCCCAGCCTTGTCCAAGGAATCCTCTCCCGTCAGCGAT
AGCGGCACTGAAGCCGACGACGAGCATTTCCTCAAGGGACTTCCGGCGCCAAAAGCTAAGCTACACAAGGGTCTT
CGTGGGCGCACCGAAACTTCGTCGGACATCTCCACTCCTATAGCCTCGCCCGGCATTCTTGAACATCAACAAGCC
CATGTCGTCGCAAAACAAGACGTCGATAGACAACGCCAGTCAGACAGCTTGCGCCGAACGAAAGCACTTGTGCGT
CGCCTGACGGAAACGGCCCTCGTTTTTTCCCTCGCTCTCATGGTGGCAACAAATCGTCGAGCATCACTGGTTTTC
AAGCTTTGGCGCAAAGGTATGGGCCTGCAACATGGAAATGGGACCACTCAAATTCCACTCTGACCGGTTGCAGAT
ATCATATCTTTAACCCTTATTTACGCTGCTTTGCTCCTGTTGTATCCGCTGCGCGTCGTAATATGGGCATATCGA
AAAAGCAACCCCTCCCAACGCTTTCCCTTCAAACTTCCCTCCAACTTTGATCCCGCTCCACTCCTCTACCCACCC
GCTATAACCATACTTGTGTCAACCCTAGTTTCAGTCGACAATGCGGCTGCTCTTTTGCCCAACATTATCCTGAGC
ATAAGCTCGATTCCTCGACCGCTGATACCCGCCATTTCCTCTACAAACGCCTACGATTCGTTGCATTGGGCTCTC
TCGTGTCTTCCTCTGATATGGCCATCTTCAGCATTACAAAATGCACCTCAGCCTACACTACGGCCGAATACAGTG
CCCGTCGAAGTTGCAGTTCTACTGTATCCCCTTCATCAGACACTATGTGTCATACTGCATCATCTTACTACTACA
AGCCTCCTGGCTGCTGAGCTTCAGCTGCTCTCTATTTCTCTCATATCGCTGCTTGTATTGGCCTTTTCTCCGCAG
ATGCAGCTATTGAAAGCATTGCTATGGGTAGGAGGATTAGGCACCTTGATACTCTGCAGTGCTGTCATCCGACGG
GGAATCGCATTGGCGCGAGTGCCCAAGTGGCGTTTTCGGAGAGCTGCGGGCCATCGACTGAGGCGCTGGAGCATC
ATGCGTCGGCTTTCGTCATGGCACAAGACCAGAGGGGACATTGCAGGGCCAGTTGTCCATGACAATCTGCTCGAC
ACAGCTTCGTCGGCCGCTGATGACGATGAATCCTCCATGAATGGTGATTCTTCTTGGGCACGCCCCATAGACTCC
CAACTGGGCTCTATTGCTGAGCGTGGCGCGCCAGCTGCGTCTTCAGACCAGGACGCAGACTCAAGCATGACTGCG
CGGCGCCATAGTATAGCGAATCTAAGAGGTTTGCCACGCAGACGCCCAACACACACCCCGTCAGGGAGAAGAAAA
AGGACAACATCGATTTCGATGCGGCCCTTTCTCAAAATGACGCAAGAGCAGGCGAATGTAAAGAAATGGCTGTAT
GCGCTCTACGTCTATAGCTCCATGTTGGCCGTCATCTTGTTGGGTGTCCGTGCCTCTATCCAATTCCATGCTCTT
GACGGCAGGGAGCCAATTGGATGGGCCCTTGGATACATGTTTGGCGACTGGTCTTGGTTTCGCTTCCAGGTGGTC
AGTGCCCACCTCGAGCGCTGGATTTGCCTGCCAGCACGAGCCAAGGCGTCGGATACTAAAGAGTGCCATATGGGC
TGGGTGCAGCATCTTCGCCACGACGAATTTGGCGAGGCAAACACGAGGCTGCTACTCAGTGGCTACTGGCTTCTT
GTCCTCACTTTGGGCCTCATCGTCGTCTTCAGACTCAAGGACAAGTATGAAGTGGATACAAGGCGCAAGGTCTTT
CATTTCACCATGGTGGGCATGCTTCTGCCGGGCACCTTTGTCGATCCTGCCTTTGCCGCATTGGCATTGGCTCTT
GTCCTTGCCGTCTTTCTGACTCTTGACCTCTTGCGGGCAAGTCAGTTGCCACCTCTGTCGAAGCCCATTGCCTCC
TTTCTGGCGCCCTACGTGGATGGTAGAGACTTTCGCGGGCCCGTTGTTATTTCCCACATCTTCCTTCTCATAGGA
TGTGCTATTCCTCTTTGGCTAGCTCTGGCTGCTCTTCCACCAACGGGAAATGGCCCCTGGGCGGGTTGGGAGTTG
GCCACTCGCGATGTCAGCATGGTCGCTGGTGTCGTTTGCGTTGGTCTTGGAGACGCAGCCGCCTCCTTGATTGGC
CGGCGCTATGGTCACCGCAAGTGGTTTTGGGGCGGTGGCAAGAGCCTTGAAGGCAGCGTTGCCTTTGCCTTTGCC
GTCTTTGCTGGACTAATAGCTGCTGCAGCTTGGTTGCGCGTGGGTGGCTGGCCTATATCAGATGGAGAGGCAAAG
ACGAGCATGCTGATGACGGCTAGTAAAGCTGGCGTCTGCGCCACAATGAGCAGCCTAGTTGAGGCAGTGCTGACA
GGCGGCAACGACAACGTCATTGTGCCCGTCATTTTGTGGACATGTGTCAAGAGCTTGGGAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail