Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1027
Gene name
LocationContig_123:8126..9993
Strand+
Gene length (bp)1867
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04084 ORC2 Origin recognition complex subunit 2 3.5E-119 253 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09142|ORC2_SCHPO Origin recognition complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc2 PE=1 SV=1 243 587 5.0E-51
sp|Q24168|ORC2_DROME Origin recognition complex subunit 2 OS=Drosophila melanogaster GN=Orc2 PE=1 SV=2 88 585 2.0E-40
sp|Q60862|ORC2_MOUSE Origin recognition complex subunit 2 OS=Mus musculus GN=Orc2 PE=1 SV=1 204 584 8.0E-40
sp|Q13416|ORC2_HUMAN Origin recognition complex subunit 2 OS=Homo sapiens GN=ORC2 PE=1 SV=2 189 584 7.0E-39
sp|P32833|ORC2_YEAST Origin recognition complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORC2 PE=1 SV=2 66 588 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09142|ORC2_SCHPO Origin recognition complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc2 PE=1 SV=1 243 587 5.0E-51
sp|Q24168|ORC2_DROME Origin recognition complex subunit 2 OS=Drosophila melanogaster GN=Orc2 PE=1 SV=2 88 585 2.0E-40
sp|Q60862|ORC2_MOUSE Origin recognition complex subunit 2 OS=Mus musculus GN=Orc2 PE=1 SV=1 204 584 8.0E-40
sp|Q13416|ORC2_HUMAN Origin recognition complex subunit 2 OS=Homo sapiens GN=ORC2 PE=1 SV=2 189 584 7.0E-39
sp|P32833|ORC2_YEAST Origin recognition complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORC2 PE=1 SV=2 66 588 1.0E-38
sp|A6QNM3|ORC2_BOVIN Origin recognition complex subunit 2 OS=Bos taurus GN=ORC2 PE=2 SV=2 189 585 4.0E-37
sp|Q10QS7|ORC2_ORYSJ Origin of replication complex subunit 2 OS=Oryza sativa subsp. japonica GN=ORC2 PE=2 SV=1 279 586 8.0E-37
sp|B8APQ0|ORC2_ORYSI Origin of replication complex subunit 2 OS=Oryza sativa subsp. indica GN=OsI_10291 PE=3 SV=1 279 586 8.0E-37
sp|Q75PQ8|ORC2_RAT Origin recognition complex subunit 2 OS=Rattus norvegicus GN=Orc2 PE=2 SV=1 216 573 1.0E-35
sp|Q38899|ORC2_ARATH Origin of replication complex subunit 2 OS=Arabidopsis thaliana GN=ORC2 PE=1 SV=1 248 586 4.0E-35
sp|Q91628|ORC2_XENLA Origin recognition complex subunit 2 OS=Xenopus laevis GN=orc2 PE=2 SV=1 189 584 8.0E-35
sp|Q21037|ORC2_CAEEL Origin recognition complex subunit 2 OS=Caenorhabditis elegans GN=orc-2 PE=2 SV=2 286 571 1.0E-14
sp|Q55CU7|ORC2_DICDI Origin recognition complex subunit 2 OS=Dictyostelium discoideum GN=orcB PE=3 SV=1 290 586 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0005634 nucleus Yes
GO:0000808 origin recognition complex Yes
GO:0043227 membrane-bounded organelle No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1027
MPPRRKPSEVVEPRKRKRTRAAADTESPPTLRQRSSSVAQQLPTVQELPEASPEDCAAATDKQLENDESFCGHED
EFAQNKEPESATTTPKRRGPSRTSAASSAAPTPKSQANVAPLPSTPSKAPASQVSTPRRLAADRSARKKSVRALV
ESVARAGASDSDFDATNDEILAQEIYGDSETDGHGVNESHDESDTDAAATTQLQDESAADEAATPSKRKRGRPRR
VKSPTPPKDLPPHEMYFFHNKPGRPKTSDNTLSSLALLTHEEYFDIMRRHKDHHSAEIDYLEALHAESFPQWAFE
LSQGFSLCLYGYGSKRSLLQRLAKYLHSTSRHHSSPNHKTVIVNGHAPAANTRDILSCIASAIDSKHKLPVSTPS
AAVANICSLLSTKDTLLTLIINSIDAPPLRKASTQTLFAQLAAHPCLHLICSADTPDFPILWDTGLRSAFSFVFH
DCTTFAPLADELNVVDDVHHLLGRASRRINGREGVAFVLRSLPENARNLFRLLASEILVACEDADVSTSDLAAIE
YRTLYNKAVEEFICSSEMAFRTLLKEFHDHQMIASRKDTIGAELLSVPFPKDELEAILEDLMS*
Coding >OphauB2|1027
ATGCCTCCTCGGCGGAAACCGTCAGAAGTAGTGGAGCCACGCAAACGCAAGCGAACTCGCGCAGCCGCCGATACT
GAGTCTCCGCCTACGCTTCGCCAGCGAAGCTCTTCTGTCGCTCAGCAGCTGCCAACCGTCCAGGAGCTACCAGAG
GCATCGCCCGAAGACTGTGCAGCTGCCACGGACAAGCAACTGGAAAATGACGAGTCATTCTGCGGCCATGAAGAC
GAATTCGCTCAAAATAAAGAGCCCGAGTCGGCCACGACGACACCGAAAAGACGCGGCCCATCAAGGACGAGTGCA
GCTTCATCAGCGGCGCCAACTCCCAAGTCGCAGGCCAATGTAGCGCCTCTTCCCTCGACACCCAGCAAGGCGCCA
GCCTCACAGGTCTCCACGCCCCGAAGACTAGCAGCAGACCGATCAGCGCGCAAAAAGAGCGTCAGAGCACTAGTT
GAAAGCGTGGCCCGTGCAGGAGCCAGCGACAGCGACTTTGATGCTACCAATGATGAAATCCTGGCTCAAGAAATA
TATGGCGATAGCGAGACTGACGGCCATGGCGTAAATGAGTCCCATGACGAATCCGACACCGACGCCGCTGCAACG
ACACAGCTCCAGGACGAAAGCGCTGCCGATGAAGCCGCTACGCCTTCCAAGCGCAAACGCGGCCGTCCAAGGCGA
GTCAAGTCTCCCACGCCGCCAAAGGACCTGCCACCGCACGAAATGTACTTTTTCCACAACAAGCCCGGCCGGCCC
AAGACGTCGGACAATACGCTCAGCTCTCTAGCGCTGCTGACGCACGAGGAATACTTTGACATTATGCGCCGACAC
AAGGATCACCACAGCGCTGAAATTGACTATCTCGAGGCTTTGCATGCCGAATCATTTCCGCAATGGGCCTTTGAG
CTGTCTCAGGGATTCAGTCTTTGCCTCTATGGCTATGGCTCCAAACGGAGCCTGCTGCAACGGTTGGCCAAGTAC
TTGCATTCGACAAGTCGCCACCACTCTTCGCCCAACCACAAGACGGTCATTGTCAATGGCCATGCCCCAGCAGCC
AACACAAGAGACATTCTCTCCTGCATCGCATCAGCCATTGATTCCAAACACAAGCTGCCAGTTTCGACACCCTCC
GCCGCCGTTGCCAACATTTGCTCTCTCCTCTCCACCAAGGACACGCTTCTCACCCTCATCATCAACTCGATTGAC
GCACCACCCTTACGCAAGGCCAGCACCCAGACACTCTTTGCACAACTCGCTGCTCATCCATGTCTCCACCTCATT
TGCTCCGCCGACACGCCCGACTTTCCCATTCTCTGGGACACGGGCTTGCGCTCCGCTTTTTCCTTTGTCTTTCAC
GACTGCACCACATTTGCGCCCCTTGCAGATGAGCTCAATGTCGTGGATGACGTCCATCATCTTTTGGGTCGTGCT
TCTCGCCGCATTAATGGCAGAGAGGGTGTGGCCTTTGTCCTTCGAAGTCTTCCAGAGAATGCAAGAAACCTGTTT
CGGCTTCTTGCCAGCGAAATCTTGGTTGCCTGCGAAGATGCAGATGTCTCCACAAGCGACTTAGCTGCCATTGAG
TATAGGACTTTGTACAACAAGGCCGTCGAAGAGTTTATTTGTAGCTCTGAGATGGCCTTTCGGACGCTGCTCAAA
GAATTTCATGATCATCAAATGATTGCCAGTCGTAAGGATACGATTGGCGCAGAGCTGCTGAGCGTTCCTTTTCCG
AAAGACGAACTAGAGGCTATACTAGAGGATCTCATGTCATGA
Transcript >OphauB2|1027
ATGCCTCCTCGGCGGAAACCGTCAGAAGTAGTGGAGCCACGCAAACGCAAGCGAACTCGCGCAGCCGCCGATACT
GAGTCTCCGCCTACGCTTCGCCAGCGAAGCTCTTCTGTCGCTCAGCAGCTGCCAACCGTCCAGGAGCTACCAGAG
GCATCGCCCGAAGACTGTGCAGCTGCCACGGACAAGCAACTGGAAAATGACGAGTCATTCTGCGGCCATGAAGAC
GAATTCGCTCAAAATAAAGAGCCCGAGTCGGCCACGACGACACCGAAAAGACGCGGCCCATCAAGGACGAGTGCA
GCTTCATCAGCGGCGCCAACTCCCAAGTCGCAGGCCAATGTAGCGCCTCTTCCCTCGACACCCAGCAAGGCGCCA
GCCTCACAGGTCTCCACGCCCCGAAGACTAGCAGCAGACCGATCAGCGCGCAAAAAGAGCGTCAGAGCACTAGTT
GAAAGCGTGGCCCGTGCAGGAGCCAGCGACAGCGACTTTGATGCTACCAATGATGAAATCCTGGCTCAAGAAATA
TATGGCGATAGCGAGACTGACGGCCATGGCGTAAATGAGTCCCATGACGAATCCGACACCGACGCCGCTGCAACG
ACACAGCTCCAGGACGAAAGCGCTGCCGATGAAGCCGCTACGCCTTCCAAGCGCAAACGCGGCCGTCCAAGGCGA
GTCAAGTCTCCCACGCCGCCAAAGGACCTGCCACCGCACGAAATGTACTTTTTCCACAACAAGCCCGGCCGGCCC
AAGACGTCGGACAATACGCTCAGCTCTCTAGCGCTGCTGACGCACGAGGAATACTTTGACATTATGCGCCGACAC
AAGGATCACCACAGCGCTGAAATTGACTATCTCGAGGCTTTGCATGCCGAATCATTTCCGCAATGGGCCTTTGAG
CTGTCTCAGGGATTCAGTCTTTGCCTCTATGGCTATGGCTCCAAACGGAGCCTGCTGCAACGGTTGGCCAAGTAC
TTGCATTCGACAAGTCGCCACCACTCTTCGCCCAACCACAAGACGGTCATTGTCAATGGCCATGCCCCAGCAGCC
AACACAAGAGACATTCTCTCCTGCATCGCATCAGCCATTGATTCCAAACACAAGCTGCCAGTTTCGACACCCTCC
GCCGCCGTTGCCAACATTTGCTCTCTCCTCTCCACCAAGGACACGCTTCTCACCCTCATCATCAACTCGATTGAC
GCACCACCCTTACGCAAGGCCAGCACCCAGACACTCTTTGCACAACTCGCTGCTCATCCATGTCTCCACCTCATT
TGCTCCGCCGACACGCCCGACTTTCCCATTCTCTGGGACACGGGCTTGCGCTCCGCTTTTTCCTTTGTCTTTCAC
GACTGCACCACATTTGCGCCCCTTGCAGATGAGCTCAATGTCGTGGATGACGTCCATCATCTTTTGGGTCGTGCT
TCTCGCCGCATTAATGGCAGAGAGGGTGTGGCCTTTGTCCTTCGAAGTCTTCCAGAGAATGCAAGAAACCTGTTT
CGGCTTCTTGCCAGCGAAATCTTGGTTGCCTGCGAAGATGCAGATGTCTCCACAAGCGACTTAGCTGCCATTGAG
TATAGGACTTTGTACAACAAGGCCGTCGAAGAGTTTATTTGTAGCTCTGAGATGGCCTTTCGGACGCTGCTCAAA
GAATTTCATGATCATCAAATGATTGCCAGTCGTAAGGATACGATTGGCGCAGAGCTGCTGAGCGTTCCTTTTCCG
AAAGACGAACTAGAGGCTATACTAGAGGATCTCATGTCATGA
Gene >OphauB2|1027
ATGCCTCCTCGGCGGAAACCGTCAGAAGTAGTGGAGCCACGCAAACGCAAGCGAACTCGCGCAGCCGCCGATACT
GAGTCTCCGCCTACGCTTCGCCAGCGAAGCTCTTCTGTCGCTCAGCAGCTGCCAACCGTCCAGGAGCTACCAGAG
GCATCGCCCGAAGACTGTGCAGCTGCCACGGACAAGCAACTGGAAAATGACGAGTCATTCTGCGGCCATGAAGAC
GAATTCGCTCAAAATAAAGAGCCCGAGTCGGCCACGACGACACCGAAAAGACGCGGCCCATCAAGGACGAGTGCA
GCTTCATCAGCGGCGCCAACTCCCAAGTCGCAGGCCAATGTAGCGCCTCTTCCCTCGACACCCAGCAAGGCGCCA
GCCTCACAGGTCTCCACGCCCCGAAGACTAGCAGCAGACCGATCAGCGCGCAAAAAGAGCGTCAGAGCACTAGTT
GAAAGCGTGGCCCGTGCAGGAGCCAGCGACAGCGACTTTGATGCTACCAATGATGAAATCCTGGCTCAAGAAATA
TATGGCGATAGCGAGACTGACGGCCATGGCGTAAATGAGTCCCATGACGAATCCGACACCGACGCCGCTGCAACG
ACACAGCTCCAGGACGAAAGCGCTGCCGATGAAGCCGCTACGCCTTCCAAGCGCAAACGCGGCCGTCCAAGGCGA
GTCAAGTCTCCCACGCCGCCAAAGGACCTGCCACCGCACGAAATGTACTTTTTCCACAACAAGCCCGGCCGGCCC
AAGACGTCGGACAATACGCTCAGCTCTCTAGCGCTGCTGACGCACGAGGAATACTTTGACATTATGCGCCGACAC
AAGGATCACCACAGCGCTGAAATTGACTATCTCGAGGCTTTGCATGCCGAATCATTTCCGCAATGGGCCTTTGAG
CTGTCTCAGGGATTCAGTCTTTGCCTCTATGGCTATGGCTCCAAACGGAGCCTGCTGCAACGGTTGGCCAAGTAC
TTGCATTCGACAAGTCGCCACCACTCTTCGCCCAACCACAAGACGGTCATTGTCAATGGCCATGCCCCAGCAGCC
AACACAAGAGACATTCTCTCCTGCATCGCATCAGCCATTGATTCCAAACACAAGCTGCCAGTTTCGACACCCTCC
GCCGCCGTTGCCAACATTTGCTCTCTCCTCTCCACCAAGGACACGCTTCTCACCCTCATCATCAACTCGATTGAC
GCACCACCCTTACGCAAGGCCAGCACCCAGACACTCTTTGCACAACTCGCTGCTCATCCATGTCTCCACCTCATT
TGCTCCGCCGACACGCCCGACTTTCCCATTCTCTGGGACACGGGCTTGCGCTCCGCTTTTTCCTTTGTCTTTCAC
GACTGCACCACATTTGCGCCCCTTGCAGATGAGCTCAATGTCGTGGATGACGTCCATCATCTTTTGGGTCGTGCT
TCTCGCCGCATTAATGGCAGAGAGGGTGTGGCCTTTGTCCTTCGAAGTCTTCCAGAGAATGCAAGAAACCTGTTT
CGGCTTCTTGCCAGCGAAATCTTGGTTGCCTGCGAAGATGCAGATGTCTCCACAAGCGACTTAGCTGCCATTGAG
TATAGGACTTTGTACAACAAGGCCGTCGAAGAGTTTATTTGTAGCTCTGAGATGGCCTTTCGGACGCTGCTCAAA
GAGTACGCCCTCTCCACCCCCCAAATTTTTTGTTTCTGGAATTTTTCGATTGAGCAACCAAAGGCGAACGAGAAA
TGCATAATACTTACTGACTGGTGCTAGATTTCATGATCATCAAATGATTGCCAGTCGTAAGGATACGATTGGCGC
AGAGCTGCTGAGCGTTCCTTTTCCGAAAGACGAACTAGAGGCTATACTAGAGGATCTCATGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail