Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1026
Gene name
LocationContig_123:7001..7675
Strand-
Gene length (bp)674
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09419 PGP_phosphatase Mitochondrial PGP phosphatase 1.5E-56 2 153
PF13242 Hydrolase_like HAD-hyrolase-like 5.5E-05 121 172

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38812|GEP4_YEAST Phosphatidylglycerophosphatase GEP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEP4 PE=1 SV=1 1 173 1.0E-43
sp|Q9Y7U3|GEP4_SCHPO Probable phosphatidylglycerophosphatase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gep4 PE=3 SV=2 3 153 2.0E-27

GO

GO Term Description Terminal node
GO:0008962 phosphatidylglycerophosphatase activity Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup525
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5581
Ophiocordyceps australis map64 (Brazil) OphauB2|1026 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05875
Ophiocordyceps camponoti-floridani Ophcf2|06455
Ophiocordyceps camponoti-floridani Ophcf2|07447
Ophiocordyceps camponoti-rufipedis Ophun1|2194
Ophiocordyceps kimflemingae Ophio5|460
Ophiocordyceps subramaniannii Hirsu2|2931

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1026
MATFNDLPIPLDKGLLSKGYKSDIRAVVLDKDDCFAFPGRLHVHEPYGKHFEALKQAYPGRKLLIVSNTAGATSW
DKQLKQAVELEQKTGIAVLAHSAKKPGCGQEIMAYFKQHPETGVTEASHIAVVGDRLMTDVLLANMMGSWALWIK
HGVVAPRDKSVWARLEHQLADLLLSRCINPPQPRAKSRG*
Coding >OphauB2|1026
ATGGCCACATTCAATGATTTGCCAATTCCTCTTGACAAGGGCTTGCTTAGCAAGGGATACAAGTCGGACATTAGG
GCTGTGGTGCTGGACAAGGACGATTGCTTTGCCTTTCCAGGCCGTTTGCATGTCCACGAGCCATACGGGAAGCAT
TTTGAGGCCTTGAAGCAAGCATATCCTGGGCGCAAGCTTCTAATTGTGTCCAACACGGCTGGCGCGACGAGCTGG
GACAAGCAATTGAAGCAGGCAGTAGAGTTGGAGCAAAAGACTGGCATTGCTGTGCTGGCTCACTCTGCCAAGAAG
CCAGGGTGCGGCCAAGAAATCATGGCCTACTTCAAACAGCATCCCGAGACGGGCGTGACTGAAGCTTCGCACATT
GCAGTTGTCGGAGATAGACTCATGACGGATGTCCTGCTAGCCAACATGATGGGTTCCTGGGCCCTTTGGATCAAA
CACGGCGTCGTTGCCCCAAGAGACAAGAGCGTGTGGGCGCGACTAGAGCACCAGCTGGCCGACTTGCTATTGTCA
CGATGCATTAATCCTCCCCAGCCGCGTGCCAAGTCGAGAGGATGA
Transcript >OphauB2|1026
ATGGCCACATTCAATGATTTGCCAATTCCTCTTGACAAGGGCTTGCTTAGCAAGGGATACAAGTCGGACATTAGG
GCTGTGGTGCTGGACAAGGACGATTGCTTTGCCTTTCCAGGCCGTTTGCATGTCCACGAGCCATACGGGAAGCAT
TTTGAGGCCTTGAAGCAAGCATATCCTGGGCGCAAGCTTCTAATTGTGTCCAACACGGCTGGCGCGACGAGCTGG
GACAAGCAATTGAAGCAGGCAGTAGAGTTGGAGCAAAAGACTGGCATTGCTGTGCTGGCTCACTCTGCCAAGAAG
CCAGGGTGCGGCCAAGAAATCATGGCCTACTTCAAACAGCATCCCGAGACGGGCGTGACTGAAGCTTCGCACATT
GCAGTTGTCGGAGATAGACTCATGACGGATGTCCTGCTAGCCAACATGATGGGTTCCTGGGCCCTTTGGATCAAA
CACGGCGTCGTTGCCCCAAGAGACAAGAGCGTGTGGGCGCGACTAGAGCACCAGCTGGCCGACTTGCTATTGTCA
CGATGCATTAATCCTCCCCAGCCGCGTGCCAAGTCGAGAGGATGA
Gene >OphauB2|1026
ATGGCCACATTCAATGATTTGCCAATTCCTCTTGACAAGGGCTTGCTTAGCAAGGGATACAAGTCGGACATTAGG
GCTGTGGTGCTGGACAAGGACGATTGCTTTGCCTTTCCAGGCCGTTTGCATGTCCACGAGCCATACGGGGTACGC
CCTCGGTTGCAGCATCAGTTAGCCAGCGAGCTTACGTCAATTGTAGAAGCATTTTGAGGCCTTGAAGCAAGCATA
TCCTGGGCGCAAGCTTCTAATTGTGTCCAACACGGCTGGCGCGACGAGCTGGGACAAGCAATTGAAGCAGGCAGT
AGAGTTGGAGCAAAAGACTGGCATTGCTGTGCTGGCTCACTCTGCCAAGAAGCCAGGGTGCGGCCAAGAAATCAT
GGCCTACTTCAAACAGCATCCCGAGACGGGCGTGACTGAAGCTTCGCACATTGCAGTTGTCGGAGATAGACTCAT
GACGGATGTCCTGCTAGCCAACATGATGGGTTCCTGGGCCCTTTGGATCAAACACGGCGTCGTTGCCCCAAGAGA
CAAGAGCGTGGTGAGTAACAAAGCCAGCGGCTCTTGGCGCACATGTCTGACGGGGTGGGTAGTGGGCGCGACTAG
AGCACCAGCTGGCCGACTTGCTATTGTCACGATGCATTAATCCTCCCCAGCCGCGTGCCAAGTCGAGAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail