Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1024
Gene name
LocationContig_123:4056..4763
Strand-
Gene length (bp)707
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family 2.1E-39 34 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1E8|TIM22_NEUCR Mitochondrial import inner membrane translocase subunit tim22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim22 PE=3 SV=2 18 174 7.0E-74
sp|Q6CRJ6|TIM22_KLULA Mitochondrial import inner membrane translocase subunit TIM22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM22 PE=3 SV=1 18 174 3.0E-55
sp|Q6FT37|TIM22_CANGA Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM22 PE=3 SV=1 31 169 1.0E-53
sp|Q75E80|TIM22_ASHGO Mitochondrial import inner membrane translocase subunit TIM22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM22 PE=3 SV=1 18 169 4.0E-52
sp|Q6BT35|TIM22_DEBHA Mitochondrial import inner membrane translocase subunit TIM22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM22 PE=3 SV=1 4 169 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1E8|TIM22_NEUCR Mitochondrial import inner membrane translocase subunit tim22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim22 PE=3 SV=2 18 174 7.0E-74
sp|Q6CRJ6|TIM22_KLULA Mitochondrial import inner membrane translocase subunit TIM22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM22 PE=3 SV=1 18 174 3.0E-55
sp|Q6FT37|TIM22_CANGA Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM22 PE=3 SV=1 31 169 1.0E-53
sp|Q75E80|TIM22_ASHGO Mitochondrial import inner membrane translocase subunit TIM22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM22 PE=3 SV=1 18 169 4.0E-52
sp|Q6BT35|TIM22_DEBHA Mitochondrial import inner membrane translocase subunit TIM22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM22 PE=3 SV=1 4 169 1.0E-45
sp|Q6BZY4|TIM22_YARLI Mitochondrial import inner membrane translocase subunit TIM22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM22 PE=3 SV=2 1 169 6.0E-45
sp|Q2UAP8|TIM22_ASPOR Mitochondrial import inner membrane translocase subunit tim22 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tim22 PE=3 SV=1 24 174 3.0E-43
sp|Q12328|TIM22_YEAST Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM22 PE=1 SV=1 31 169 5.0E-40
sp|P0CR88|TIM22_CRYNJ Mitochondrial import inner membrane translocase subunit TIM22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM22 PE=3 SV=1 14 174 1.0E-36
sp|P0CR89|TIM22_CRYNB Mitochondrial import inner membrane translocase subunit TIM22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM22 PE=3 SV=1 14 174 1.0E-36
sp|Q9JKW1|TIM22_RAT Mitochondrial import inner membrane translocase subunit Tim22 OS=Rattus norvegicus GN=Timm22 PE=2 SV=2 15 169 4.0E-27
sp|Q9CQ85|TIM22_MOUSE Mitochondrial import inner membrane translocase subunit Tim22 OS=Mus musculus GN=Timm22 PE=1 SV=1 15 169 9.0E-27
sp|Q5BIN4|TIM22_BOVIN Mitochondrial import inner membrane translocase subunit Tim22 OS=Bos taurus GN=TIMM22 PE=2 SV=1 15 169 1.0E-25
sp|P87146|TIM22_SCHPO Mitochondrial import inner membrane translocase subunit tim22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim22 PE=3 SV=1 32 169 2.0E-25
sp|Q9Y584|TIM22_HUMAN Mitochondrial import inner membrane translocase subunit Tim22 OS=Homo sapiens GN=TIMM22 PE=1 SV=2 15 169 3.0E-25
sp|Q5M7K0|TIM22_XENTR Mitochondrial import inner membrane translocase subunit Tim22 OS=Xenopus tropicalis GN=timm22 PE=2 SV=1 4 169 6.0E-25
sp|Q5U4U5|TIM22_XENLA Mitochondrial import inner membrane translocase subunit Tim22 OS=Xenopus laevis GN=timm22 PE=2 SV=1 4 169 1.0E-24
sp|Q9NAQ9|TIM22_CAEEL Mitochondrial import inner membrane translocase subunit tim-22 OS=Caenorhabditis elegans GN=tim-22 PE=3 SV=1 25 169 1.0E-19
sp|Q8IN78|TIM22_DROME Mitochondrial import inner membrane translocase subunit Tim22 OS=Drosophila melanogaster GN=Tim22 PE=2 SV=1 16 168 3.0E-18
sp|Q54QM0|TIM22_DICDI Mitochondrial import inner membrane translocase subunit tim22 OS=Dictyostelium discoideum GN=timm22 PE=3 SV=1 31 168 5.0E-16
sp|A2RVP7|TI221_ARATH Mitochondrial import inner membrane translocase subunit TIM22-1 OS=Arabidopsis thaliana GN=TIM22-1 PE=1 SV=1 79 165 2.0E-15
sp|A1XJK0|TI224_ARATH Mitochondrial import inner membrane translocase subunit TIM22-4 OS=Arabidopsis thaliana GN=TIM22-4 PE=2 SV=3 68 165 3.0E-15
sp|O60830|TI17B_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-B OS=Homo sapiens GN=TIMM17B PE=1 SV=1 82 152 2.0E-06
sp|Q9Z0V7|TI17B_MOUSE Mitochondrial import inner membrane translocase subunit Tim17-B OS=Mus musculus GN=Timm17b PE=1 SV=1 82 152 3.0E-06
sp|O44477|TIM17_CAEEL Probable mitochondrial import inner membrane translocase subunit Tim17 OS=Caenorhabditis elegans GN=tim-17 PE=3 SV=1 90 165 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1024
MNSLPGPSAGAAAPIPGSPQDPSVKAVQAAMESCFGKSVMSGVMGFGMGGLFGMFMASMSYDTPFGTPVTNSAGQ
SISSLPLRQQLKLGFRDMGARSYSMARNFGKVGALFAGIECGIEGLRAKNDLANGVAAGCLTGGILAKNAGPQAV
AGGCVAFAAFSAAIDAWMRQPKDE*
Coding >OphauB2|1024
ATGAACTCGCTGCCAGGCCCGTCCGCGGGCGCCGCTGCGCCAATACCTGGCAGCCCTCAGGACCCCAGCGTCAAG
GCTGTTCAAGCAGCAATGGAGTCGTGCTTTGGCAAGTCTGTCATGTCGGGCGTCATGGGATTCGGCATGGGCGGT
TTATTTGGCATGTTTATGGCCTCGATGTCGTACGACACCCCCTTTGGTACTCCCGTGACAAACTCGGCAGGCCAG
AGCATCTCGTCGCTACCCCTGCGCCAACAACTCAAGCTCGGCTTCCGCGACATGGGCGCACGCTCCTACTCCATG
GCCCGCAACTTTGGCAAGGTTGGAGCGCTCTTTGCAGGCATCGAGTGCGGCATCGAGGGCCTCCGCGCTAAGAAC
GACCTTGCAAACGGCGTGGCTGCCGGCTGTCTGACTGGCGGCATTCTTGCCAAGAATGCTGGTCCACAGGCCGTT
GCGGGAGGCTGCGTTGCCTTTGCTGCCTTTAGCGCCGCCATTGATGCCTGGATGAGACAGCCCAAGGATGAATAA
Transcript >OphauB2|1024
ATGAACTCGCTGCCAGGCCCGTCCGCGGGCGCCGCTGCGCCAATACCTGGCAGCCCTCAGGACCCCAGCGTCAAG
GCTGTTCAAGCAGCAATGGAGTCGTGCTTTGGCAAGTCTGTCATGTCGGGCGTCATGGGATTCGGCATGGGCGGT
TTATTTGGCATGTTTATGGCCTCGATGTCGTACGACACCCCCTTTGGTACTCCCGTGACAAACTCGGCAGGCCAG
AGCATCTCGTCGCTACCCCTGCGCCAACAACTCAAGCTCGGCTTCCGCGACATGGGCGCACGCTCCTACTCCATG
GCCCGCAACTTTGGCAAGGTTGGAGCGCTCTTTGCAGGCATCGAGTGCGGCATCGAGGGCCTCCGCGCTAAGAAC
GACCTTGCAAACGGCGTGGCTGCCGGCTGTCTGACTGGCGGCATTCTTGCCAAGAATGCTGGTCCACAGGCCGTT
GCGGGAGGCTGCGTTGCCTTTGCTGCCTTTAGCGCCGCCATTGATGCCTGGATGAGACAGCCCAAGGATGAATAA
Gene >OphauB2|1024
ATGAACTCGCTGCCAGGCCCGTCCGCGGGCGCCGCTGCGCCAATACCTGGCAGCCCTCAGGACCCCAGCGTCAAG
GCTGTAAGTCGCCATCTACTTTGGCAAGACTCGACTCCGAGGGGGCTAACGACGAAGGCGATTTCAGGTTCAAGC
AGCAATGGAGTCGTGCTTTGGCAAGTCTGTCATGTCGGGCGTCATGGGATTCGGCATGGGCGGTTTATTTGGCAT
GTTTATGGCCTCGGTGCGCTTTTCCCGACCCCATTGTCCCTTGCTTCATTCATTTTAAACACAGCATGACGAGCC
ACCTATCAATCACAGCCCTTGTGGCAATCATGGTCTGACCTCGTCTCCCTATACAGATGTCGTACGACACCCCCT
TTGGTACTCCCGTGACAAACTCGGCAGGCCAGAGCATCTCGTCGCTACCCCTGCGCCAACAACTCAAGCTCGGCT
TCCGCGACATGGGCGCACGCTCCTACTCCATGGCCCGCAACTTTGGCAAGGTTGGAGCGCTCTTTGCAGGCATCG
AGTGCGGCATCGAGGGCCTCCGCGCTAAGAACGACCTTGCAAACGGCGTGGCTGCCGGCTGTCTGACTGGCGGCA
TTCTTGCCAAGAATGCTGGTCCACAGGCCGTTGCGGGAGGCTGCGTTGCCTTTGCTGCCTTTAGCGCCGCCATTG
ATGCCTGGATGAGACAGCCCAAGGATGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail