Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1021
Gene name
LocationContig_122:60348..62034
Strand-
Gene length (bp)1686
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 1.5E-30 342 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 245 559 2.0E-39
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 343 529 9.0E-27
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 334 529 4.0E-25
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 337 529 1.0E-24
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 344 529 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 245 559 2.0E-39
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 343 529 9.0E-27
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 334 529 4.0E-25
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 337 529 1.0E-24
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 344 529 1.0E-23
sp|P25646|PDP2_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC6 PE=1 SV=2 376 529 1.0E-22
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 350 526 5.0E-14
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 351 543 6.0E-14
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 375 526 1.0E-13
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 349 526 2.0E-13
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 351 526 2.0E-13
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 349 526 2.0E-13
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 344 526 2.0E-13
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 351 526 2.0E-13
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 351 526 2.0E-13
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 350 526 3.0E-13
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 351 526 5.0E-13
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 349 526 7.0E-13
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 349 510 1.0E-12
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 349 526 2.0E-12
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 349 523 4.0E-12
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 376 511 1.0E-11
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 351 526 1.0E-11
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 376 526 2.0E-11
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 349 526 2.0E-11
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1 376 511 4.0E-11
sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryza sativa subsp. japonica GN=Os11g0109000 PE=2 SV=1 376 510 4.0E-11
sp|Q6L482|P2C48_ORYSJ Probable protein phosphatase 2C 48 OS=Oryza sativa subsp. japonica GN=Os05g0358500 PE=2 SV=1 376 521 7.0E-11
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 349 509 8.0E-11
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 351 526 9.0E-11
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 351 515 1.0E-10
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 351 515 1.0E-10
sp|O82637|P2C61_ARATH Probable protein phosphatase 2C 61 OS=Arabidopsis thaliana GN=At4g32950 PE=3 SV=1 376 514 2.0E-10
sp|Q5R522|PPM1K_PONAB Protein phosphatase 1K, mitochondrial OS=Pongo abelii GN=PPM1K PE=2 SV=1 334 488 2.0E-10
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 376 512 3.0E-10
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 349 526 3.0E-10
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 349 510 4.0E-10
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 376 526 7.0E-10
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 351 507 1.0E-09
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 351 526 1.0E-09
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 348 487 2.0E-09
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 351 526 2.0E-09
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 376 526 2.0E-09
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 351 526 3.0E-09
sp|Q9M9W9|P2C34_ARATH Probable protein phosphatase 2C 34 OS=Arabidopsis thaliana GN=At3g05640 PE=2 SV=1 375 521 4.0E-09
sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza sativa subsp. japonica GN=Os07g0566200 PE=2 SV=2 374 510 4.0E-09
sp|A3CCP9|P2C76_ORYSJ Putative protein phosphatase 2C 76 OS=Oryza sativa subsp. japonica GN=Os11g0586001 PE=3 SV=2 344 527 6.0E-09
sp|Q0WRB2|P2C73_ARATH Probable protein phosphatase 2C 73 OS=Arabidopsis thaliana GN=PPC6-7 PE=2 SV=1 375 510 6.0E-09
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 349 493 7.0E-09
sp|Q9XGZ9|P2C72_ARATH Probable protein phosphatase 2C 72 OS=Arabidopsis thaliana GN=At5g26010 PE=2 SV=2 376 492 7.0E-09
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 349 493 9.0E-09
sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryza sativa subsp. japonica GN=Os04g0321800 PE=2 SV=2 376 509 9.0E-09
sp|Q9FG61|P2C74_ARATH Probable protein phosphatase 2C 74 OS=Arabidopsis thaliana GN=At5g36250 PE=1 SV=1 376 510 1.0E-08
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 351 507 1.0E-08
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 351 521 1.0E-08
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 376 500 2.0E-08
sp|A0DSB3|PP2C6_PARTE Probable protein phosphatase 2C 6 OS=Paramecium tetraurelia GN=GSPATT00019634001 PE=3 SV=1 351 526 2.0E-08
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 348 527 2.0E-08
sp|Q93YS2|P2C51_ARATH Probable protein phosphatase 2C 51 OS=Arabidopsis thaliana GN=At3g63340 PE=2 SV=2 347 510 2.0E-08
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 324 528 3.0E-08
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 351 523 3.0E-08
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 376 526 4.0E-08
sp|Q54T01|Y2105_DICDI Probable protein phosphatase DDB_G0282105 OS=Dictyostelium discoideum GN=DDB_G0282105 PE=3 SV=1 351 526 4.0E-08
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 351 524 5.0E-08
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 351 489 8.0E-08
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 348 527 9.0E-08
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 351 526 9.0E-08
sp|Q8GY60|P2C52_ARATH Probable protein phosphatase 2C 52 OS=Arabidopsis thaliana GN=At4g03415 PE=2 SV=1 374 492 1.0E-07
sp|Q8H2T0|P2C65_ORYSJ Probable protein phosphatase 2C 65 OS=Oryza sativa subsp. japonica GN=Os07g0646100 PE=2 SV=1 436 520 1.0E-07
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 351 493 1.0E-07
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 348 527 2.0E-07
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 351 493 2.0E-07
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 348 527 2.0E-07
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 293 493 2.0E-07
sp|Q84JI0|P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica GN=Os03g0268600 PE=2 SV=1 376 493 2.0E-07
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 251 526 3.0E-07
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 351 493 3.0E-07
sp|Q9SA22|P2C06_ARATH Probable protein phosphatase 2C 6 OS=Arabidopsis thaliana GN=At1g16220 PE=2 SV=1 376 509 3.0E-07
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 378 496 4.0E-07
sp|Q8RXZ4|P2C18_ARATH Probable protein phosphatase 2C 18 OS=Arabidopsis thaliana GN=At1g79630 PE=2 SV=1 376 510 9.0E-07
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 351 486 1.0E-06
sp|Q9SL76|P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana GN=At2g20050/At2g20040 PE=2 SV=2 375 543 1.0E-06
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 368 526 2.0E-06
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 352 493 3.0E-06
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 347 493 5.0E-06
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 349 526 6.0E-06
sp|Q9M8R7|P2C33_ARATH Probable protein phosphatase 2C 33 OS=Arabidopsis thaliana GN=PPC6-1 PE=1 SV=1 376 510 6.0E-06
sp|Q6ZKL8|P2C66_ORYSJ Probable protein phosphatase 2C 66 OS=Oryza sativa subsp. japonica GN=Os08g0500300 PE=2 SV=1 376 510 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1021
MASLTHRTSRGASTRLEKLAKALSGRRRFHTYFVTHLPSSSLHPDSRSPSHKLPRDASTPHTPSPGSAPAVALPN
MLTRDLTVVRIPLRRAKHHFGSYSARGSRPYNEDADQAGIIDMPAFAQRAPMSIKQKPGEATPADTASGDPQIFY
FGIFDGHGGTQCSHFLRDELHGYIERTVADFGLESSLRKQKPGRLESPPLTDKRALDSLEVQGPDGVKDRLELPQ
HGGMPSHGSAVPSAKSVPAKVHDQEGVLDLQRGLVEAYRNTIGGYFRRFNPEHLRGSADTDSSPITVESSLAYAF
LRADLDFVSAQARKPDGDESDLPLNNDDILGAPHARRSGQAMGDALRFKGGSTASIALISTPTPVPFWHPAAHST
MLVAHVGDSRILMCDTATGLPRPLTSDHHPGSPTESRRLRRYAPAGSMVSGDSFGEERIAGLANSRAFGDIASKR
IGVSAEPEITRVEMGPAQYSFLVLVTDGVSASLSDQEIVDVVKEARTPEQGARSVVEYATEVSIDGDNATCQVVR
LGGWERRSEGGLGSLGTKEIRDIRRAEAQDPRRANR*
Coding >OphauB2|1021
ATGGCCTCCCTCACGCACCGGACAAGTCGCGGCGCCTCGACAAGGCTCGAGAAGCTTGCAAAGGCGCTCTCGGGC
CGCCGGCGCTTCCACACCTACTTTGTCACGCACCTGCCGTCGTCGTCGCTGCATCCAGACTCGCGCAGCCCGAGC
CACAAGCTGCCGCGCGATGCCTCGACGCCTCACACGCCCAGTCCCGGGTCGGCGCCCGCCGTGGCGCTGCCCAAT
ATGCTGACGCGCGATCTGACCGTGGTGCGCATTCCCTTGCGGCGTGCAAAACATCACTTTGGTTCTTACTCGGCG
CGGGGGAGCCGCCCGTACAATGAAGATGCAGACCAGGCCGGCATTATAGACATGCCCGCCTTTGCCCAGAGGGCA
CCCATGAGCATCAAGCAGAAGCCAGGCGAGGCCACTCCGGCAGACACGGCGTCGGGTGATCCGCAGATTTTTTAC
TTTGGCATCTTTGATGGCCATGGCGGAACCCAGTGCTCCCACTTTTTGCGCGATGAGCTGCACGGCTACATTGAA
AGGACGGTGGCCGACTTTGGCCTCGAGAGCAGCCTGAGAAAGCAGAAGCCCGGGCGCCTCGAGTCGCCGCCCTTG
ACTGACAAGCGCGCCCTCGACTCGCTTGAGGTGCAGGGGCCCGACGGCGTCAAGGACCGCCTCGAGCTTCCTCAG
CACGGCGGAATGCCGTCTCATGGCAGCGCAGTGCCCAGTGCCAAGTCGGTTCCCGCAAAGGTGCACGACCAAGAG
GGCGTCTTGGACCTTCAAAGGGGGCTCGTTGAAGCCTACAGAAACACTATTGGCGGCTACTTTCGACGCTTCAAC
CCGGAGCACCTGCGTGGTAGCGCCGACACCGACTCGTCGCCCATCACGGTCGAGTCGAGCCTGGCCTATGCCTTT
TTGCGTGCCGACCTCGACTTTGTGTCGGCCCAGGCGCGGAAGCCCGATGGCGACGAGTCGGATCTTCCTCTCAAC
AACGATGACATTCTCGGCGCACCACACGCGCGCCGCTCGGGCCAGGCAATGGGCGACGCCCTCCGCTTCAAGGGC
GGCTCCACCGCCTCGATTGCCCTCATCTCAACGCCCACCCCCGTGCCCTTTTGGCATCCTGCCGCCCACTCCACC
ATGCTTGTTGCCCATGTTGGCGACAGCCGCATCCTCATGTGCGACACGGCAACGGGGCTGCCCCGGCCCCTCACC
TCGGATCATCACCCGGGCTCCCCCACCGAGAGCAGACGGCTGCGCCGCTACGCACCCGCCGGCTCCATGGTTTCC
GGCGATAGTTTTGGCGAGGAGCGCATCGCCGGTCTGGCAAACAGCCGCGCCTTTGGCGACATTGCCAGCAAGCGC
ATCGGCGTCTCGGCCGAGCCTGAAATCACGCGCGTCGAAATGGGGCCCGCCCAGTATTCCTTTCTCGTCCTCGTC
ACCGATGGCGTGTCAGCCTCGCTGAGCGACCAGGAAATCGTCGACGTGGTCAAGGAGGCACGCACCCCCGAACAG
GGCGCCCGCAGCGTCGTCGAGTACGCCACCGAAGTCTCCATCGACGGCGACAATGCCACTTGCCAGGTTGTCCGC
CTCGGCGGCTGGGAGCGGCGCTCCGAGGGCGGGCTCGGAAGCCTCGGCACAAAGGAGATTCGCGACATTCGCCGT
GCCGAAGCCCAAGATCCCCGCAGAGCCAATCGGTGA
Transcript >OphauB2|1021
ATGGCCTCCCTCACGCACCGGACAAGTCGCGGCGCCTCGACAAGGCTCGAGAAGCTTGCAAAGGCGCTCTCGGGC
CGCCGGCGCTTCCACACCTACTTTGTCACGCACCTGCCGTCGTCGTCGCTGCATCCAGACTCGCGCAGCCCGAGC
CACAAGCTGCCGCGCGATGCCTCGACGCCTCACACGCCCAGTCCCGGGTCGGCGCCCGCCGTGGCGCTGCCCAAT
ATGCTGACGCGCGATCTGACCGTGGTGCGCATTCCCTTGCGGCGTGCAAAACATCACTTTGGTTCTTACTCGGCG
CGGGGGAGCCGCCCGTACAATGAAGATGCAGACCAGGCCGGCATTATAGACATGCCCGCCTTTGCCCAGAGGGCA
CCCATGAGCATCAAGCAGAAGCCAGGCGAGGCCACTCCGGCAGACACGGCGTCGGGTGATCCGCAGATTTTTTAC
TTTGGCATCTTTGATGGCCATGGCGGAACCCAGTGCTCCCACTTTTTGCGCGATGAGCTGCACGGCTACATTGAA
AGGACGGTGGCCGACTTTGGCCTCGAGAGCAGCCTGAGAAAGCAGAAGCCCGGGCGCCTCGAGTCGCCGCCCTTG
ACTGACAAGCGCGCCCTCGACTCGCTTGAGGTGCAGGGGCCCGACGGCGTCAAGGACCGCCTCGAGCTTCCTCAG
CACGGCGGAATGCCGTCTCATGGCAGCGCAGTGCCCAGTGCCAAGTCGGTTCCCGCAAAGGTGCACGACCAAGAG
GGCGTCTTGGACCTTCAAAGGGGGCTCGTTGAAGCCTACAGAAACACTATTGGCGGCTACTTTCGACGCTTCAAC
CCGGAGCACCTGCGTGGTAGCGCCGACACCGACTCGTCGCCCATCACGGTCGAGTCGAGCCTGGCCTATGCCTTT
TTGCGTGCCGACCTCGACTTTGTGTCGGCCCAGGCGCGGAAGCCCGATGGCGACGAGTCGGATCTTCCTCTCAAC
AACGATGACATTCTCGGCGCACCACACGCGCGCCGCTCGGGCCAGGCAATGGGCGACGCCCTCCGCTTCAAGGGC
GGCTCCACCGCCTCGATTGCCCTCATCTCAACGCCCACCCCCGTGCCCTTTTGGCATCCTGCCGCCCACTCCACC
ATGCTTGTTGCCCATGTTGGCGACAGCCGCATCCTCATGTGCGACACGGCAACGGGGCTGCCCCGGCCCCTCACC
TCGGATCATCACCCGGGCTCCCCCACCGAGAGCAGACGGCTGCGCCGCTACGCACCCGCCGGCTCCATGGTTTCC
GGCGATAGTTTTGGCGAGGAGCGCATCGCCGGTCTGGCAAACAGCCGCGCCTTTGGCGACATTGCCAGCAAGCGC
ATCGGCGTCTCGGCCGAGCCTGAAATCACGCGCGTCGAAATGGGGCCCGCCCAGTATTCCTTTCTCGTCCTCGTC
ACCGATGGCGTGTCAGCCTCGCTGAGCGACCAGGAAATCGTCGACGTGGTCAAGGAGGCACGCACCCCCGAACAG
GGCGCCCGCAGCGTCGTCGAGTACGCCACCGAAGTCTCCATCGACGGCGACAATGCCACTTGCCAGGTTGTCCGC
CTCGGCGGCTGGGAGCGGCGCTCCGAGGGCGGGCTCGGAAGCCTCGGCACAAAGGAGATTCGCGACATTCGCCGT
GCCGAAGCCCAAGATCCCCGCAGAGCCAATCGGTGA
Gene >OphauB2|1021
ATGGCCTCCCTCACGCACCGGACAAGTCGCGGCGCCTCGACAAGGCTCGAGAAGCTTGCAAAGGCGCTCTCGGGC
CGCCGGCGCTTCCACACCTACTTTGTCACGCACCTGCCGTCGTCGTCGCTGCATCCAGACTCGCGCAGCCCGAGC
CACAAGCTGCCGCGCGATGCCTCGACGCCTCACACGCCCAGTCCCGGGTCGGCGCCCGCCGTGGCGCTGCCCAAT
ATGCTGACGCGCGATCTGACCGTGGTGCGCATTCCCTTGCGGCGTGCAAAACATCACTTTGGTTCTTACTCGGCG
CGGGGGAGCCGCCCGTACAATGAAGATGCAGACCAGGCCGGCATTATAGACATGCCCGCCTTTGCCCAGAGGGCA
CCCATGAGCATCAAGCAGAAGCCAGGCGAGGCCACTCCGGCAGACACGGCGTCGGGTGATCCGCAGATTTTTTAC
TTTGGCATCTTTGATGGCCATGGCGGAACCCAGTGCTCCCACTTTTTGCGCGATGAGCTGCACGGCTACATTGAA
AGGACGGTGGCCGACTTTGGCCTCGAGAGCAGCCTGAGAAAGCAGAAGCCCGGGCGCCTCGAGTCGCCGCCCTTG
ACTGACAAGCGCGCCCTCGACTCGCTTGAGGTGCAGGGGCCCGACGGCGTCAAGGACCGCCTCGAGCTTCCTCAG
CACGGCGGAATGCCGTCTCATGGCAGCGCAGTGCCCAGTGCCAAGTCGGTTCCCGCAAAGGTGCACGACCAAGAG
GGCGTCTTGGACCTTCAAAGGGGGCTCGTTGAAGCCTACAGAAACACTATTGGCGGCTACTTTCGACGCTTCAAC
CCGGAGCACCTGCGTGGTAGCGCCGACACCGACTCGTCGCCCATCACGGTCGAGTCGAGCCTGGCCTATGCCTTT
TTGCGTGCCGACCTCGACTTTGTGTCGGCCCAGGCGCGGAAGCCCGATGGCGACGAGTCGGATCTTCCTCTCAAC
AACGATGACATTCTCGGCGCACCACACGCGCGCCGCTCGGGCCAGGCAATGGGCGACGCCCTCCGCTTCAAGGGC
GGCTCCACCGCCTCGATTGCCCTCATCTCAACGCCCACCCCCGTGCCCTTTTGGCATCCTGCCGCCCACTCCACC
ATGCTTGTTGCCCATGTTGGCGACAGCCGCATCCTCATGTGCGACACGGCAACGGGGCTGCCCCGGCCCCTCACC
TCGGATCATCACCCGGGCTCCCCCACCGAGAGCAGACGGCTGCGCCGCTACGCACCCGCCGGCTCCATGGTTTCC
GGCGATAGTTTTGGCGAGGAGCGCATCGCCGGTCTGGCAAACAGCCGCGCCTTTGGCGACATTGCCAGCAAGCGC
ATCGGCGTCTCGGCCGAGCCTGAAATCACGCGCGTCGAAATGGGGCCCGCCCAGTATTCCTTTCTCGTCCTCGTC
ACCGATGGCGTGTCAGCCTCGCTGAGCGACCAGGAAATCGTCGACGTGGTCAAGGAGGCACGCACCCCCGAACAG
GGCGCCCGCAGCGTCGTCGAGTACGCCACCGAAGTCTCCATCGACGGCGACAATGCCACTTGCCAGGTTGTCCGC
CTCGGCGGCTGGGAGCGGCGCTCCGAGGGCGGGCTCGGAAGCCTCGGCACAAAGGAGATTCGCGACATTCGCCGT
GCCGAAGCCCAAGATCCCCGCAGAGCCAATCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail