Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1018
Gene name
LocationContig_122:52620..54446
Strand-
Gene length (bp)1826
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.8E-14 162 228
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.8E-20 262 331
PF15519 RBM39linker linker between RRM2 and RRM3 domains in RBM39 protein 8.8E-24 388 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 153 540 1.0E-100
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 155 535 2.0E-64
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 155 535 5.0E-64
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 155 535 5.0E-64
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 91 341 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 153 540 1.0E-100
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 155 535 2.0E-64
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 155 535 5.0E-64
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 155 535 5.0E-64
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 91 341 2.0E-44
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 144 339 2.0E-18
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 153 342 6.0E-18
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 162 333 3.0E-17
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 162 338 8.0E-17
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 153 332 7.0E-16
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 162 333 1.0E-15
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 162 333 1.0E-15
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 162 333 1.0E-15
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 162 333 1.0E-15
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 162 333 1.0E-15
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 150 338 3.0E-15
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 154 339 3.0E-15
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 162 333 5.0E-15
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 161 332 6.0E-15
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 154 335 1.0E-14
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 155 339 1.0E-14
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 150 338 2.0E-14
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 162 338 2.0E-14
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 162 338 5.0E-14
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 154 340 8.0E-14
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 145 335 8.0E-14
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 153 332 2.0E-13
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 162 339 2.0E-13
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 162 333 3.0E-13
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 134 338 4.0E-13
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 162 338 4.0E-13
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 134 338 5.0E-13
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 134 338 5.0E-13
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 162 338 5.0E-13
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 162 338 5.0E-13
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 162 338 5.0E-13
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 162 338 5.0E-13
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 162 338 5.0E-13
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 134 338 5.0E-13
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 134 346 6.0E-13
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 151 338 6.0E-13
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 162 333 7.0E-13
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 162 338 7.0E-13
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 162 338 7.0E-13
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 155 356 8.0E-13
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 162 333 9.0E-13
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 162 338 1.0E-12
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 162 338 1.0E-12
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 162 338 1.0E-12
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 162 333 1.0E-12
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 162 333 1.0E-12
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 162 333 2.0E-12
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 162 333 2.0E-12
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 162 332 2.0E-12
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 184 333 2.0E-12
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 143 339 2.0E-12
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 156 333 3.0E-12
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 161 332 3.0E-12
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 134 339 3.0E-12
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 156 334 3.0E-12
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 136 332 4.0E-12
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 162 338 4.0E-12
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 161 335 4.0E-12
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 154 333 5.0E-12
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 134 338 6.0E-12
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 162 338 7.0E-12
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 161 333 8.0E-12
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 106 338 9.0E-12
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 137 336 1.0E-11
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 145 335 1.0E-11
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 162 339 1.0E-11
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 137 336 1.0E-11
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 145 335 1.0E-11
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 161 332 1.0E-11
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 152 333 2.0E-11
sp|Q80YT9|RBM11_MOUSE Splicing regulator RBM11 OS=Mus musculus GN=Rbm11 PE=1 SV=1 152 259 2.0E-11
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 143 333 2.0E-11
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 145 335 2.0E-11
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 162 333 2.0E-11
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 141 338 2.0E-11
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 160 317 3.0E-11
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 157 332 3.0E-11
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 137 336 3.0E-11
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 162 333 3.0E-11
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 162 333 3.0E-11
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 152 333 4.0E-11
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 152 333 4.0E-11
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 184 333 4.0E-11
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 152 333 4.0E-11
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 152 333 4.0E-11
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 162 333 4.0E-11
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 157 333 5.0E-11
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 147 339 5.0E-11
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 162 357 5.0E-11
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 161 333 7.0E-11
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 152 333 7.0E-11
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 156 338 7.0E-11
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 145 345 8.0E-11
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 144 333 8.0E-11
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 162 339 9.0E-11
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 161 333 9.0E-11
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 150 356 1.0E-10
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 152 333 1.0E-10
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 162 338 1.0E-10
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 262 348 1.0E-10
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 161 335 1.0E-10
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 135 334 1.0E-10
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 154 365 1.0E-10
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 158 338 1.0E-10
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 147 339 1.0E-10
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 147 339 1.0E-10
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 147 339 1.0E-10
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 153 339 1.0E-10
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 162 333 2.0E-10
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 147 333 2.0E-10
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 162 332 2.0E-10
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 112 339 2.0E-10
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 145 335 2.0E-10
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 158 338 2.0E-10
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 183 333 3.0E-10
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 145 335 3.0E-10
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 151 346 3.0E-10
sp|P57052|RBM11_HUMAN Splicing regulator RBM11 OS=Homo sapiens GN=RBM11 PE=1 SV=1 152 259 3.0E-10
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 159 332 3.0E-10
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 141 335 3.0E-10
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 158 366 3.0E-10
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 158 339 3.0E-10
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 158 339 4.0E-10
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 158 339 4.0E-10
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 122 334 4.0E-10
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 162 333 4.0E-10
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 162 333 5.0E-10
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 136 332 5.0E-10
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 152 332 5.0E-10
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 152 332 5.0E-10
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 160 352 6.0E-10
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 162 333 6.0E-10
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 262 332 6.0E-10
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 152 332 6.0E-10
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 152 332 6.0E-10
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 155 322 6.0E-10
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 261 335 7.0E-10
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 147 339 7.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 159 333 8.0E-10
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 162 332 9.0E-10
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 145 335 1.0E-09
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 162 333 1.0E-09
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 162 333 1.0E-09
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 161 333 1.0E-09
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 153 351 1.0E-09
sp|Q9Y2U8|MAN1_HUMAN Inner nuclear membrane protein Man1 OS=Homo sapiens GN=LEMD3 PE=1 SV=2 441 523 1.0E-09
sp|Q9JJ54|HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus GN=Hnrnpd PE=1 SV=2 140 337 1.0E-09
sp|Q9WU40|MAN1_MOUSE Inner nuclear membrane protein Man1 OS=Mus musculus GN=Lemd3 PE=1 SV=2 441 523 1.0E-09
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 262 338 1.0E-09
sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens GN=HNRNPD PE=1 SV=1 140 337 1.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 152 333 2.0E-09
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 158 333 2.0E-09
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 162 333 2.0E-09
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 162 333 2.0E-09
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 162 333 2.0E-09
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 198 332 2.0E-09
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 162 333 2.0E-09
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 152 333 2.0E-09
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 156 333 2.0E-09
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 162 375 2.0E-09
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 147 339 2.0E-09
sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 140 337 2.0E-09
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 261 332 2.0E-09
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 152 308 2.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 162 333 2.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 147 333 2.0E-09
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 150 339 2.0E-09
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 140 319 2.0E-09
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 161 320 2.0E-09
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 153 308 2.0E-09
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 159 333 3.0E-09
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 140 332 3.0E-09
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 141 337 3.0E-09
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 162 333 3.0E-09
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 260 339 3.0E-09
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 260 348 3.0E-09
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 174 318 3.0E-09
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 161 320 3.0E-09
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 162 333 3.0E-09
sp|O57406|CEL1A_XENLA CUGBP Elav-like family member 1-A OS=Xenopus laevis GN=cugbp1-a PE=1 SV=1 152 332 3.0E-09
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 261 332 3.0E-09
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 261 332 3.0E-09
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 153 308 3.0E-09
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 261 332 3.0E-09
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 162 335 4.0E-09
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 161 335 4.0E-09
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 152 338 4.0E-09
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 162 338 4.0E-09
sp|Q55GD6|SF3B4_DICDI Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 161 351 4.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 201 333 5.0E-09
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 161 335 5.0E-09
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 161 338 5.0E-09
sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrnpdl PE=1 SV=1 174 318 5.0E-09
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 262 332 5.0E-09
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 158 391 6.0E-09
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 261 332 6.0E-09
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 162 332 6.0E-09
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 162 338 6.0E-09
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 161 346 7.0E-09
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 159 333 7.0E-09
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 159 333 7.0E-09
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 162 338 7.0E-09
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 156 338 8.0E-09
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 261 332 8.0E-09
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 261 332 8.0E-09
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 261 332 8.0E-09
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 154 332 8.0E-09
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 162 338 9.0E-09
sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrnpdl PE=1 SV=1 174 318 9.0E-09
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 141 337 9.0E-09
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 158 333 1.0E-08
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 116 335 1.0E-08
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 162 352 1.0E-08
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 111 334 1.0E-08
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 145 335 1.0E-08
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 174 318 1.0E-08
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 153 343 1.0E-08
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 261 332 1.0E-08
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 161 335 2.0E-08
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 147 333 2.0E-08
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 147 338 2.0E-08
sp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A OS=Arabidopsis thaliana GN=UBA2A PE=1 SV=1 160 319 2.0E-08
sp|Q5F3T7|CELF1_CHICK CUGBP Elav-like family member 1 OS=Gallus gallus GN=CELF1 PE=1 SV=2 152 332 2.0E-08
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 153 319 2.0E-08
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 158 338 2.0E-08
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 152 332 2.0E-08
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 162 335 2.0E-08
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 158 339 2.0E-08
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 161 333 2.0E-08
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 137 371 2.0E-08
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 158 343 2.0E-08
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 158 336 2.0E-08
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 257 333 3.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 184 333 3.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 184 333 3.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 184 333 3.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 184 333 3.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 184 333 3.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 184 333 3.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 145 335 3.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 261 332 3.0E-08
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 162 333 3.0E-08
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 261 332 3.0E-08
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 157 310 3.0E-08
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 154 337 3.0E-08
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 162 322 4.0E-08
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 158 339 4.0E-08
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 156 332 4.0E-08
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 154 331 4.0E-08
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 162 337 4.0E-08
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 154 334 5.0E-08
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 154 339 5.0E-08
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 162 333 5.0E-08
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 252 332 5.0E-08
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 260 332 5.0E-08
sp|Q6PHZ5|RB15B_MOUSE Putative RNA-binding protein 15B OS=Mus musculus GN=Rbm15b PE=1 SV=2 152 327 5.0E-08
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 262 332 5.0E-08
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 158 333 6.0E-08
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 162 337 6.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 261 332 6.0E-08
sp|Q8NDT2|RB15B_HUMAN Putative RNA-binding protein 15B OS=Homo sapiens GN=RBM15B PE=1 SV=3 152 327 7.0E-08
sp|Q9LPI5|CID11_ARATH Polyadenylate-binding protein-interacting protein 11 OS=Arabidopsis thaliana GN=CID11 PE=2 SV=1 126 332 7.0E-08
sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrnpdl PE=2 SV=1 153 318 7.0E-08
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 154 339 8.0E-08
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 262 335 8.0E-08
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 155 337 8.0E-08
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 156 322 8.0E-08
sp|Q92879|CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens GN=CELF1 PE=1 SV=2 152 320 8.0E-08
sp|Q7TSY6|CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus GN=Celf4 PE=1 SV=2 156 322 9.0E-08
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 153 319 9.0E-08
sp|Q5NVC8|CELF4_PONAB CUGBP Elav-like family member 4 OS=Pongo abelii GN=CELF4 PE=2 SV=2 156 322 9.0E-08
sp|Q9BZC1|CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens GN=CELF4 PE=1 SV=1 156 322 9.0E-08
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 257 333 1.0E-07
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 257 333 1.0E-07
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 257 333 1.0E-07
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 257 333 1.0E-07
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 162 333 1.0E-07
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 162 339 1.0E-07
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 162 339 1.0E-07
sp|Q9IBD0|CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio GN=celf1 PE=1 SV=1 152 332 1.0E-07
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 261 335 1.0E-07
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 154 332 1.0E-07
sp|Q6DGV1|CELF4_DANRE CUGBP Elav-like family member 4 OS=Danio rerio GN=celf4 PE=2 SV=1 156 322 1.0E-07
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 152 332 1.0E-07
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 159 328 1.0E-07
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 257 333 2.0E-07
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 257 333 2.0E-07
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 188 351 2.0E-07
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 188 351 2.0E-07
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 188 351 2.0E-07
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 158 338 2.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 162 339 2.0E-07
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 159 333 2.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 162 335 2.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 261 332 2.0E-07
sp|P28659|CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus GN=Celf1 PE=1 SV=2 152 320 2.0E-07
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 260 332 2.0E-07
sp|Q4QQT3|CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus GN=Celf1 PE=2 SV=1 152 320 2.0E-07
sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 254 332 2.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 261 332 2.0E-07
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 162 321 2.0E-07
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 261 332 2.0E-07
sp|Q5R995|CELF1_PONAB CUGBP Elav-like family member 1 OS=Pongo abelii GN=CELF1 PE=2 SV=1 152 320 2.0E-07
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 261 334 2.0E-07
sp|Q8GZ26|BRN2L_ARATH RNA-binding protein BRN2 OS=Arabidopsis thaliana GN=BRN2 PE=2 SV=1 250 334 2.0E-07
sp|Q4R535|CELF4_MACFA CUGBP Elav-like family member 4 OS=Macaca fascicularis GN=CELF4 PE=2 SV=1 156 322 2.0E-07
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 261 332 2.0E-07
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 261 332 2.0E-07
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 198 351 3.0E-07
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 188 351 3.0E-07
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 192 335 3.0E-07
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 261 332 3.0E-07
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 261 332 3.0E-07
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 261 332 3.0E-07
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 260 363 3.0E-07
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 262 360 3.0E-07
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 158 328 3.0E-07
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 260 332 3.0E-07
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 262 334 3.0E-07
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 261 332 3.0E-07
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 262 334 3.0E-07
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 152 366 3.0E-07
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 262 332 3.0E-07
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 261 332 3.0E-07
sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 254 332 3.0E-07
sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrnpdl-a PE=2 SV=1 174 318 3.0E-07
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 262 334 3.0E-07
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 262 334 3.0E-07
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 201 328 3.0E-07
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 188 338 4.0E-07
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 162 333 4.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 162 333 4.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 145 345 4.0E-07
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 260 332 4.0E-07
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 162 337 4.0E-07
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 262 332 4.0E-07
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 233 348 4.0E-07
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 152 337 4.0E-07
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 261 342 5.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 161 333 5.0E-07
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 152 337 5.0E-07
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 154 339 5.0E-07
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 159 322 5.0E-07
sp|P40561|SGN1_YEAST RNA-binding protein SGN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGN1 PE=1 SV=1 156 223 5.0E-07
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 260 330 5.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 151 349 6.0E-07
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 161 335 6.0E-07
sp|Q7TN33|CELF6_MOUSE CUGBP Elav-like family member 6 OS=Mus musculus GN=Celf6 PE=2 SV=1 156 322 6.0E-07
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 160 307 6.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 261 332 6.0E-07
sp|P0C1I2|PPIE_RHIO9 Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 262 334 6.0E-07
sp|Q8JZX4|SPF45_MOUSE Splicing factor 45 OS=Mus musculus GN=Rbm17 PE=1 SV=1 417 524 6.0E-07
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 154 308 6.0E-07
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 157 332 7.0E-07
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 162 335 7.0E-07
sp|Q9C652|RBP1_ARATH RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBP1 PE=2 SV=1 156 359 7.0E-07
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 154 308 7.0E-07
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 156 322 7.0E-07
sp|Q6NU14|HNDLB_XENLA Heterogeneous nuclear ribonucleoprotein D-like-B OS=Xenopus laevis GN=hnrnpdl-b PE=2 SV=1 174 318 7.0E-07
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 154 308 7.0E-07
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 160 307 7.0E-07
sp|Q9LHP2|SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 251 337 7.0E-07
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 180 334 8.0E-07
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 180 334 8.0E-07
sp|Q5F3T7|CELF1_CHICK CUGBP Elav-like family member 1 OS=Gallus gallus GN=CELF1 PE=1 SV=2 262 334 8.0E-07
sp|Q92879|CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens GN=CELF1 PE=1 SV=2 262 334 8.0E-07
sp|P28659|CELF1_MOUSE CUGBP Elav-like family member 1 OS=Mus musculus GN=Celf1 PE=1 SV=2 262 334 8.0E-07
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 160 307 8.0E-07
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 160 307 8.0E-07
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 256 332 8.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 159 333 9.0E-07
sp|Q4QQT3|CELF1_RAT CUGBP Elav-like family member 1 OS=Rattus norvegicus GN=Celf1 PE=2 SV=1 262 334 9.0E-07
sp|Q5R995|CELF1_PONAB CUGBP Elav-like family member 1 OS=Pongo abelii GN=CELF1 PE=2 SV=1 262 334 9.0E-07
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 261 338 9.0E-07
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 261 332 9.0E-07
sp|Q28HE9|CELF1_XENTR CUGBP Elav-like family member 1 OS=Xenopus tropicalis GN=celf1 PE=2 SV=1 262 334 9.0E-07
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 160 307 9.0E-07
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 160 307 9.0E-07
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 160 307 9.0E-07
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 160 307 9.0E-07
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 261 332 9.0E-07
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 262 353 1.0E-06
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 148 332 1.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 162 335 1.0E-06
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 160 334 1.0E-06
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 162 338 1.0E-06
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 154 331 1.0E-06
sp|Q28HE9|CELF1_XENTR CUGBP Elav-like family member 1 OS=Xenopus tropicalis GN=celf1 PE=2 SV=1 152 332 1.0E-06
sp|Q6PF35|CEL1B_XENLA CUGBP Elav-like family member 1-B OS=Xenopus laevis GN=cugbp1-b PE=2 SV=1 262 334 1.0E-06
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 250 332 1.0E-06
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 250 332 1.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 162 333 1.0E-06
sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 261 334 1.0E-06
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 262 332 1.0E-06
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 162 332 1.0E-06
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 262 334 1.0E-06
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 262 334 1.0E-06
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 262 334 1.0E-06
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 262 334 1.0E-06
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 261 332 1.0E-06
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 261 334 1.0E-06
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 260 332 1.0E-06
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 261 334 1.0E-06
sp|Q8VE97|SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus GN=Srsf4 PE=2 SV=1 162 332 1.0E-06
sp|O57406|CEL1A_XENLA CUGBP Elav-like family member 1-A OS=Xenopus laevis GN=cugbp1-a PE=1 SV=1 262 334 2.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 162 338 2.0E-06
sp|Q9IBD0|CELF1_DANRE CUGBP Elav-like family member 1 OS=Danio rerio GN=celf1 PE=1 SV=1 262 334 2.0E-06
sp|Q6PF35|CEL1B_XENLA CUGBP Elav-like family member 1-B OS=Xenopus laevis GN=cugbp1-b PE=2 SV=1 152 332 2.0E-06
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 261 332 2.0E-06
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 261 332 2.0E-06
sp|Q08170|SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens GN=SRSF4 PE=1 SV=2 162 332 2.0E-06
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 261 334 2.0E-06
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 261 332 2.0E-06
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 260 332 2.0E-06
sp|Q96J87|CELF6_HUMAN CUGBP Elav-like family member 6 OS=Homo sapiens GN=CELF6 PE=1 SV=1 156 322 2.0E-06
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 261 334 2.0E-06
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 162 332 2.0E-06
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 156 321 2.0E-06
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 156 321 2.0E-06
sp|Q6P0B1|CELF2_DANRE CUGBP Elav-like family member 2 OS=Danio rerio GN=celf2 PE=2 SV=1 262 334 2.0E-06
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 261 332 2.0E-06
sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 261 334 2.0E-06
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 262 332 2.0E-06
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 261 332 2.0E-06
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 161 328 2.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 261 332 2.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 261 332 2.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 261 332 2.0E-06
sp|A4IIM2|CELF2_XENTR CUGBP Elav-like family member 2 OS=Xenopus tropicalis GN=celf2 PE=2 SV=1 262 334 2.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 261 332 2.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 261 332 2.0E-06
sp|Q5R8Y8|CELF2_PONAB CUGBP Elav-like family member 2 OS=Pongo abelii GN=CELF2 PE=2 SV=2 262 334 2.0E-06
sp|O95319|CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens GN=CELF2 PE=1 SV=1 262 334 2.0E-06
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 155 332 3.0E-06
sp|Q6P0B1|CELF2_DANRE CUGBP Elav-like family member 2 OS=Danio rerio GN=celf2 PE=2 SV=1 153 320 3.0E-06
sp|Q792H5|CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus GN=Celf2 PE=2 SV=1 262 334 3.0E-06
sp|Q9Z0H4|CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus GN=Celf2 PE=1 SV=1 262 334 3.0E-06
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 262 334 3.0E-06
sp|Q7ZXE2|CELF2_XENLA CUGBP Elav-like family member 2 OS=Xenopus laevis GN=celf2 PE=1 SV=1 262 334 3.0E-06
sp|Q7T2T1|CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus GN=CELF2 PE=1 SV=2 262 334 3.0E-06
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 260 332 3.0E-06
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 160 307 3.0E-06
sp|B5DGI7|RBM8A_SALSA RNA-binding protein 8A OS=Salmo salar GN=rbm8a PE=2 SV=1 248 335 3.0E-06
sp|Q9JJW6|ALRF2_MOUSE Aly/REF export factor 2 OS=Mus musculus GN=Alyref2 PE=1 SV=1 250 334 3.0E-06
sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 162 316 3.0E-06
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 248 332 3.0E-06
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 160 333 4.0E-06
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 260 334 4.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 171 338 4.0E-06
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 237 332 4.0E-06
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 260 332 4.0E-06
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 201 337 4.0E-06
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 201 337 4.0E-06
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 261 332 4.0E-06
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 261 342 4.0E-06
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 158 322 4.0E-06
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 150 322 4.0E-06
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 155 322 4.0E-06
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 158 322 4.0E-06
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 245 338 5.0E-06
sp|Q792H5|CELF2_RAT CUGBP Elav-like family member 2 OS=Rattus norvegicus GN=Celf2 PE=2 SV=1 153 332 5.0E-06
sp|Q9Z0H4|CELF2_MOUSE CUGBP Elav-like family member 2 OS=Mus musculus GN=Celf2 PE=1 SV=1 153 332 5.0E-06
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 231 339 5.0E-06
sp|Q4KM14|TSP1L_DANRE tRNA selenocysteine 1-associated protein 1-like OS=Danio rerio GN=trnau1apl PE=2 SV=1 190 335 5.0E-06
sp|Q5R8Y8|CELF2_PONAB CUGBP Elav-like family member 2 OS=Pongo abelii GN=CELF2 PE=2 SV=2 153 332 6.0E-06
sp|O95319|CELF2_HUMAN CUGBP Elav-like family member 2 OS=Homo sapiens GN=CELF2 PE=1 SV=1 153 332 6.0E-06
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 262 347 7.0E-06
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 155 322 7.0E-06
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 262 369 7.0E-06
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 262 369 7.0E-06
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 260 332 7.0E-06
sp|Q293V6|NCBP2_DROPS Nuclear cap-binding protein subunit 2 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp20 PE=3 SV=1 262 379 7.0E-06
sp|B4GLK8|NCBP2_DROPE Nuclear cap-binding protein subunit 2 OS=Drosophila persimilis GN=Cbp20 PE=3 SV=1 262 379 7.0E-06
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 156 321 7.0E-06
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 261 356 8.0E-06
sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 262 369 9.0E-06
sp|Q3ZBJ1|NCBP2_BOVIN Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 262 369 9.0E-06
sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 262 379 9.0E-06
sp|B4LZ88|NCB2B_DROVI Nuclear cap-binding protein subunit 2B OS=Drosophila virilis GN=Cbp20-B PE=3 SV=1 262 379 9.0E-06
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 157 221 9.0E-06
sp|Q7T2T1|CELF2_CHICK CUGBP Elav-like family member 2 OS=Gallus gallus GN=CELF2 PE=1 SV=2 153 332 1.0E-05
sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 262 379 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1018
MANYDVEALLEATEEHAGKQKGGSTMGSSPDTRIRDGHSRERDQQRGRDRHRHRDRREGSLRSDSGSNSSRIGAR
NNRPHHRRNRDGDYYRTGRGRSRSRSRSRSTRRYRERDDRHRRDRRDGHDRRSADRGRGRERERERDRDRRSRTP
KPNEDERDSRTVFVQQLANRLRDEKLQRFFEDNAGPVNEVQIVKDRVSGRSKGVGYVEFKHPESVQKALQLTGRI
LENIPIIVRLTEAEKNRQARKTDESGGQTNSASFHRLYIGNIHFNVTQQDLVAVFEPFGELEYAQLQMDEHNRSK
GFGFVQYKKAANAKEALEKMNGFELAGRPIRVGLGNERSGGDGNRNHGQNSANFQGSAFSGAGGRGPAAAFDRAG
GRDNERNGGGGALDDSDVAGVNFNNYSRDALMRKLARTDETSNSRDEAQALQPKTEVKPLPVNVSSASRCVVLRN
MFDPDEEEGDNWVQELEEDVRSEAEKKYGHVVHIAVDANSKGDIYLKFDKVQGGENAIKGLNGRYFGGRMINASP
VVDAFYSSMFSRARAI*
Coding >OphauB2|1018
ATGGCCAACTACGATGTTGAGGCTCTTTTGGAGGCCACTGAGGAGCATGCCGGTAAGCAAAAGGGGGGCAGCACC
ATGGGCAGTTCTCCCGACACCAGGATTCGTGATGGACACTCGCGAGAGCGAGATCAACAACGTGGGCGAGACCGC
CACCGCCATCGAGACCGTCGCGAAGGGAGTCTTCGTAGTGATTCTGGTAGCAATAGCAGCCGTATTGGCGCTCGC
AACAATCGGCCGCATCACCGCCGAAATCGAGATGGTGATTATTACCGTACGGGCCGAGGCCGTTCTCGGTCTCGG
TCTCGATCTCGATCGACTCGCCGTTATCGTGAGCGTGATGATCGCCACCGTCGCGACCGACGAGATGGCCATGAC
CGTCGTTCGGCAGATCGTGGTCGTGGTCGCGAGCGTGAGCGTGAGCGCGATCGTGACCGTCGCTCACGTACACCG
AAACCGAATGAAGACGAGAGAGACAGTCGGACTGTCTTTGTACAGCAATTGGCAAATAGACTTCGCGACGAGAAG
TTGCAAAGATTCTTCGAAGACAACGCAGGGCCTGTCAATGAAGTGCAGATTGTTAAAGACCGCGTCAGCGGCAGG
TCTAAAGGCGTTGGTTATGTTGAATTCAAGCACCCAGAGTCTGTTCAAAAGGCGCTTCAATTGACTGGGAGGATA
CTCGAAAACATCCCTATCATTGTTCGTCTCACCGAGGCGGAGAAGAACCGACAAGCCCGCAAGACAGACGAGTCT
GGCGGCCAAACCAACTCTGCCTCTTTCCACCGCCTCTACATTGGAAACATTCATTTCAACGTCACACAACAAGAT
CTGGTGGCAGTTTTCGAACCATTTGGCGAGCTTGAGTATGCTCAGTTGCAAATGGATGAACATAATCGTAGCAAG
GGTTTTGGCTTCGTCCAATACAAAAAGGCAGCAAATGCAAAGGAGGCTCTGGAAAAGATGAATGGATTTGAGCTT
GCTGGTCGTCCAATTCGCGTTGGCCTGGGCAATGAGCGATCAGGTGGTGACGGTAACCGAAATCACGGACAAAAC
AGCGCCAATTTCCAGGGCTCAGCCTTTTCCGGAGCCGGTGGAAGAGGCCCTGCGGCAGCTTTTGATCGGGCTGGG
GGAAGAGACAACGAGCGAAACGGCGGTGGAGGAGCCTTGGATGATTCTGACGTGGCTGGAGTCAATTTCAATAAT
TACAGTCGCGATGCGTTGATGAGAAAGCTTGCCAGGACCGACGAAACTTCGAACAGCCGAGATGAAGCACAGGCC
TTGCAGCCCAAGACTGAGGTGAAGCCGCTTCCCGTCAATGTGAGCAGCGCGAGCCGTTGCGTTGTCTTGCGTAAC
ATGTTCGACCCAGACGAAGAAGAGGGTGACAACTGGGTCCAGGAATTGGAAGAAGACGTGCGATCAGAGGCGGAG
AAAAAGTACGGTCACGTTGTTCACATAGCCGTCGATGCCAACTCCAAGGGCGACATCTATTTGAAATTTGACAAG
GTGCAGGGCGGCGAAAACGCGATCAAAGGTCTCAACGGAAGATATTTTGGCGGCCGCATGATCAACGCCTCCCCG
GTCGTGGACGCTTTTTACAGCAGCATGTTTTCCCGCGCCCGAGCCATCTGA
Transcript >OphauB2|1018
ATGGCCAACTACGATGTTGAGGCTCTTTTGGAGGCCACTGAGGAGCATGCCGGTAAGCAAAAGGGGGGCAGCACC
ATGGGCAGTTCTCCCGACACCAGGATTCGTGATGGACACTCGCGAGAGCGAGATCAACAACGTGGGCGAGACCGC
CACCGCCATCGAGACCGTCGCGAAGGGAGTCTTCGTAGTGATTCTGGTAGCAATAGCAGCCGTATTGGCGCTCGC
AACAATCGGCCGCATCACCGCCGAAATCGAGATGGTGATTATTACCGTACGGGCCGAGGCCGTTCTCGGTCTCGG
TCTCGATCTCGATCGACTCGCCGTTATCGTGAGCGTGATGATCGCCACCGTCGCGACCGACGAGATGGCCATGAC
CGTCGTTCGGCAGATCGTGGTCGTGGTCGCGAGCGTGAGCGTGAGCGCGATCGTGACCGTCGCTCACGTACACCG
AAACCGAATGAAGACGAGAGAGACAGTCGGACTGTCTTTGTACAGCAATTGGCAAATAGACTTCGCGACGAGAAG
TTGCAAAGATTCTTCGAAGACAACGCAGGGCCTGTCAATGAAGTGCAGATTGTTAAAGACCGCGTCAGCGGCAGG
TCTAAAGGCGTTGGTTATGTTGAATTCAAGCACCCAGAGTCTGTTCAAAAGGCGCTTCAATTGACTGGGAGGATA
CTCGAAAACATCCCTATCATTGTTCGTCTCACCGAGGCGGAGAAGAACCGACAAGCCCGCAAGACAGACGAGTCT
GGCGGCCAAACCAACTCTGCCTCTTTCCACCGCCTCTACATTGGAAACATTCATTTCAACGTCACACAACAAGAT
CTGGTGGCAGTTTTCGAACCATTTGGCGAGCTTGAGTATGCTCAGTTGCAAATGGATGAACATAATCGTAGCAAG
GGTTTTGGCTTCGTCCAATACAAAAAGGCAGCAAATGCAAAGGAGGCTCTGGAAAAGATGAATGGATTTGAGCTT
GCTGGTCGTCCAATTCGCGTTGGCCTGGGCAATGAGCGATCAGGTGGTGACGGTAACCGAAATCACGGACAAAAC
AGCGCCAATTTCCAGGGCTCAGCCTTTTCCGGAGCCGGTGGAAGAGGCCCTGCGGCAGCTTTTGATCGGGCTGGG
GGAAGAGACAACGAGCGAAACGGCGGTGGAGGAGCCTTGGATGATTCTGACGTGGCTGGAGTCAATTTCAATAAT
TACAGTCGCGATGCGTTGATGAGAAAGCTTGCCAGGACCGACGAAACTTCGAACAGCCGAGATGAAGCACAGGCC
TTGCAGCCCAAGACTGAGGTGAAGCCGCTTCCCGTCAATGTGAGCAGCGCGAGCCGTTGCGTTGTCTTGCGTAAC
ATGTTCGACCCAGACGAAGAAGAGGGTGACAACTGGGTCCAGGAATTGGAAGAAGACGTGCGATCAGAGGCGGAG
AAAAAGTACGGTCACGTTGTTCACATAGCCGTCGATGCCAACTCCAAGGGCGACATCTATTTGAAATTTGACAAG
GTGCAGGGCGGCGAAAACGCGATCAAAGGTCTCAACGGAAGATATTTTGGCGGCCGCATGATCAACGCCTCCCCG
GTCGTGGACGCTTTTTACAGCAGCATGTTTTCCCGCGCCCGAGCCATCTGA
Gene >OphauB2|1018
ATGGCCAACTACGATGTTGAGGCTCTTTTGGAGGCCACTGAGGAGCATGCCGGTAAGCAAAAGGGGGGCAGCACC
ATGGGCAGTTCTCCCGACACCAGGATTCGTGATGGACACTCGCGAGAGCGAGATCAACAACGTGGGCGAGACCGC
CACCGCCATCGAGACCGTCGCGAAGGGAGTCTTCGTAGTGATTCTGGTAGCAATAGCAGCCGTATTGGCGCTCGC
AACAATCGGCCGCATCACCGCCGAAATCGAGATGGTGATTATTACCGTACGGGCCGAGGCCGTTCTCGGTCTCGG
TCTCGATCTCGATCGACTCGCCGTTATCGTGAGCGTGATGATCGCCACCGTCGCGACCGACGAGATGGCCATGAC
CGTCGTTCGGCAGATCGTGGTCGTGGTCGCGAGCGTGAGCGTGAGCGCGATCGTGACCGTCGCTCACGTACACCG
AAACCGAATGAAGACGAGAGAGACAGTCGGACTGTCTTTGTACAGCAATTGGCAAATAGACTTCGCGACGAGAAG
TTGCAAAGATTCTTCGAAGACAACGCAGGGCCTGTCAATGAAGTGCAGATTGTTAAAGACCGCGTCAGCGGCAGG
TCTAAAGGGTGAGCCTTCTTGGACCTCGAGTTCTTTGGTTGACACGCCCTGTTTCCTTGCCCCAGTGCTAATAGG
ATTCATGCGGGACCAATCCAGCGTTGGTTATGTTGAATTCAAGCACCCAGAGTCTGTTCAAAAGGCGCTTCAATT
GACTGGGAGGATACTCGAAAACATCCCTATCATTGTTCGTCTCACCGAGGCGGAGAAGAACCGACAAGCCCGCAA
GACAGACGAGTCTGGCGGCCAAACCAACTCTGCCTCTTTCCACCGCCTCTACATTGGAAACATTCATTTCAACGT
CACACAACAAGATCTGGTGGCAGTTTTCGAACCATTTGGCGAGCTTGAGTATGCTCAGTTGCAAATGGATGAACA
TAATCGTAGCAAGGGTTTTGGCTTCGTCCAGTGGGTGCCTCGTGGCTGTATGAGGTTCCATTACATGACTGACAT
GTTCAAAACAGATACAAAAAGGCAGCAAATGCAAAGGAGGCTCTGGAAAAGATGAATGGATTTGAGCTTGCTGGT
CGTCCAATTCGCGTTGGCCTGGGCAATGAGCGATCAGGTGGTGACGGTAACCGAAATCACGGACAAAACAGCGCC
AATTTCCAGGGCTCAGCCTTTTCCGGAGCCGGTGGAAGAGGCCCTGCGGCAGCTTTTGATCGGGCTGGGGGAAGA
GACAACGAGCGAAACGGCGGTGGAGGAGCCTTGGATGATTCTGACGTGGCTGGAGTCAATTTCAATAATTACAGT
CGCGATGCGTTGATGAGAAAGCTTGCCAGGACCGACGAAACTTCGAACAGCCGAGATGAAGCACAGGCCTTGCAG
CCCAAGACTGAGGTGAAGCCGCTTCCCGTCAATGTGAGCAGCGCGAGCCGTTGCGTTGTCTTGCGTAACATGTTC
GACCCAGACGAGTAAGTAATGTTCTTGTTATTGCCTCTGAGCTTGCTACTGACACGCGGCTGTGTAGAGAAGAGG
GTGACAACTGGGTCCAGGAATTGGAAGAAGACGTGCGATCAGAGGCGGAGAAAAAGTACGGTCACGTTGTTCACA
TAGCCGTCGATGCCAACTCCAAGGGCGACATCTATTTGAAATTTGACAAGGTGCAGGGCGGCGAAAACGCGATCA
AAGGTCTCAACGGAAGATATTTTGGCGGCCGCATGATCAACGCCTCCCCGGTCGTGGACGCTTTTTACAGCAGCA
TGTTTTCCCGCGCCCGAGCCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail