Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1015
Gene name
LocationContig_122:45245..47164
Strand+
Gene length (bp)1919
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 3.8E-33 84 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14909|AAT_SULSO Aspartate aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspC PE=1 SV=2 115 455 2.0E-26
sp|O67781|AAT_AQUAE Aspartate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=aspC PE=3 SV=1 85 460 5.0E-26
sp|O58489|AAT_PYRHO Aspartate aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspC PE=3 SV=1 80 463 2.0E-25
sp|P53001|AAT1_BACSU Aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=aspB PE=3 SV=1 114 462 2.0E-22
sp|E9L7A5|PAT_PETHY Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Petunia hybrida PE=1 SV=1 115 459 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14909|AAT_SULSO Aspartate aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspC PE=1 SV=2 115 455 2.0E-26
sp|O67781|AAT_AQUAE Aspartate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=aspC PE=3 SV=1 85 460 5.0E-26
sp|O58489|AAT_PYRHO Aspartate aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspC PE=3 SV=1 80 463 2.0E-25
sp|P53001|AAT1_BACSU Aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=aspB PE=3 SV=1 114 462 2.0E-22
sp|E9L7A5|PAT_PETHY Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Petunia hybrida PE=1 SV=1 115 459 2.0E-22
sp|Q5F4K8|PAT_PINPS Aspartate aminotransferase OS=Pinus pinaster GN=AAT PE=1 SV=1 115 457 3.0E-21
sp|O86459|AAT_RHILP Aspartate aminotransferase OS=Rhizobium leguminosarum bv. phaseoli GN=aspC PE=3 SV=1 85 439 7.0E-21
sp|Q55128|AAT_SYNY3 Aspartate aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aspC PE=3 SV=1 115 460 2.0E-20
sp|Q972A2|AAT_SULTO Aspartate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspC PE=3 SV=1 115 460 3.0E-20
sp|Q56232|AAT_THET8 Aspartate aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspC PE=1 SV=1 114 461 4.0E-20
sp|Q9X0Y2|AAT_THEMA Aspartate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aspC PE=1 SV=1 70 460 8.0E-20
sp|Q9SIE1|PAT_ARATH Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Arabidopsis thaliana GN=PAT PE=1 SV=2 115 459 1.0E-19
sp|P16524|PATA_BACSU Putative N-acetyl-LL-diaminopimelate aminotransferase OS=Bacillus subtilis (strain 168) GN=patA PE=1 SV=3 115 465 3.0E-19
sp|Q9V0L2|AAT_PYRAB Aspartate aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspC PE=3 SV=1 84 463 9.0E-19
sp|B2A250|DAPAT_NATTJ LL-diaminopimelate aminotransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=dapL PE=3 SV=1 80 418 1.0E-17
sp|Q58097|MFNC_METJA (5-formylfuran-3-yl)methyl phosphate transaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnC PE=1 SV=2 115 461 4.0E-17
sp|Q02635|AATA_RHIME Aspartate aminotransferase A OS=Rhizobium meliloti (strain 1021) GN=aatA PE=3 SV=1 85 444 5.0E-17
sp|Q3AC10|DAPAT_CARHZ LL-diaminopimelate aminotransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dapL PE=3 SV=1 114 421 9.0E-17
sp|Q60317|AAT_METJA Probable aspartate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0001 PE=3 SV=1 84 458 1.0E-16
sp|Q9ZE56|AAT_RICPR Aspartate aminotransferase OS=Rickettsia prowazekii (strain Madrid E) GN=aatA PE=3 SV=2 85 421 2.0E-16
sp|P39643|AAT2_BACSU Probable aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=ywfG PE=3 SV=1 84 425 2.0E-16
sp|Q9HUI9|ARUH_PSEAE Arginine--pyruvate transaminase AruH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruH PE=1 SV=1 115 388 3.0E-16
sp|O33822|AAT_THEAQ Aspartate aminotransferase OS=Thermus aquaticus GN=aspC PE=3 SV=1 114 453 4.0E-16
sp|Q4J8X2|AAT_SULAC Aspartate aminotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aspC PE=3 SV=1 115 461 5.0E-16
sp|Q1RGV0|AAT_RICBR Aspartate aminotransferase OS=Rickettsia bellii (strain RML369-C) GN=aatA PE=3 SV=1 85 457 8.0E-16
sp|B8DJJ6|DAPAT_DESVM LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dapL PE=3 SV=1 114 461 2.0E-15
sp|Q59228|AAT_GEOSE Aspartate aminotransferase OS=Geobacillus stearothermophilus GN=aspC PE=3 SV=1 56 457 2.0E-15
sp|O66630|DAPAT_AQUAE LL-diaminopimelate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=dapL PE=3 SV=1 114 388 3.0E-15
sp|Q4UND3|AAT_RICFE Aspartate aminotransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=aatA PE=3 SV=1 85 457 5.0E-15
sp|H3ZPU1|ARAT2_THELN Aromatic-amino-acid aminotransferase 2 OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=OCC_04737 PE=1 SV=1 115 463 8.0E-15
sp|Q68XV9|AAT_RICTY Aspartate aminotransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=aatA PE=3 SV=1 85 460 9.0E-15
sp|Q795M6|YUGH_BACSU Putative aminotransferase YugH OS=Bacillus subtilis (strain 168) GN=yugH PE=3 SV=1 115 461 9.0E-15
sp|P23034|AAT_BACY2 Aspartate aminotransferase OS=Bacillus sp. (strain YM-2) PE=1 SV=1 85 459 1.0E-14
sp|Q72BI1|DAPAT_DESVH LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dapL PE=3 SV=1 114 440 2.0E-14
sp|A1VDD3|DAPAT_DESVV LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dapL PE=3 SV=1 114 440 2.0E-14
sp|Q2RK33|DAPAT_MOOTA LL-diaminopimelate aminotransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=dapL PE=1 SV=1 115 385 2.0E-14
sp|B1I544|DAPAT_DESAP LL-diaminopimelate aminotransferase OS=Desulforudis audaxviator (strain MP104C) GN=dapL PE=3 SV=1 114 413 3.0E-14
sp|B8CX89|DAPAT_HALOH LL-diaminopimelate aminotransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dapL PE=3 SV=1 111 385 5.0E-14
sp|Q9SIV0|SUR1_ARATH S-alkyl-thiohydroximate lyase SUR1 OS=Arabidopsis thaliana GN=SUR1 PE=1 SV=1 24 464 5.0E-14
sp|Q92JE7|AAT_RICCN Aspartate aminotransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=aatA PE=3 SV=1 84 460 2.0E-13
sp|A0LEA5|DAPAT_SYNFM LL-diaminopimelate aminotransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dapL PE=1 SV=1 84 385 3.0E-13
sp|Q16773|KAT1_HUMAN Kynurenine--oxoglutarate transaminase 1 OS=Homo sapiens GN=CCBL1 PE=1 SV=1 71 441 4.0E-13
sp|Q08415|KAT1_RAT Kynurenine--oxoglutarate transaminase 1, mitochondrial OS=Rattus norvegicus GN=Ccbl1 PE=1 SV=1 72 397 6.0E-13
sp|Q30ZX9|DAPAT_DESAG LL-diaminopimelate aminotransferase OS=Desulfovibrio alaskensis (strain G20) GN=dapL PE=3 SV=1 114 415 1.0E-12
sp|Q54KM6|KAT_DICDI Kynurenine--oxoglutarate transaminase OS=Dictyostelium discoideum GN=ccbl PE=3 SV=1 204 384 1.0E-12
sp|Q796Q6|YISV_BACSU Uncharacterized HTH-type transcriptional regulator YisV OS=Bacillus subtilis (strain 168) GN=yisV PE=3 SV=1 86 419 5.0E-12
sp|Q8BTY1|KAT1_MOUSE Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus GN=Ccbl1 PE=1 SV=1 72 397 6.0E-12
sp|Q6YP21|KAT3_HUMAN Kynurenine--oxoglutarate transaminase 3 OS=Homo sapiens GN=CCBL2 PE=1 SV=1 35 400 6.0E-12
sp|Q71RI9|KAT3_MOUSE Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus GN=Ccbl2 PE=1 SV=1 17 397 6.0E-12
sp|Q58FK9|KAT3_RAT Kynurenine--oxoglutarate transaminase 3 OS=Rattus norvegicus GN=Ccbl2 PE=2 SV=1 35 397 2.0E-11
sp|C6BUK3|DAPAT_DESAD LL-diaminopimelate aminotransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dapL PE=3 SV=1 114 415 2.0E-11
sp|P58350|AATB_RHIME Aspartate aminotransferase B OS=Rhizobium meliloti (strain 1021) GN=aatB PE=3 SV=1 85 461 3.0E-11
sp|Q60013|AAT_STRVG Aspartate aminotransferase OS=Streptomyces virginiae GN=aspC PE=3 SV=1 115 463 4.0E-11
sp|Q0P5G4|KAT3_BOVIN Kynurenine--oxoglutarate transaminase 3 OS=Bos taurus GN=CCBL2 PE=2 SV=1 35 384 4.0E-11
sp|Q9STR4|1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana GN=ACS7 PE=1 SV=1 120 307 4.0E-11
sp|P77434|ALAC_ECOLI Glutamate-pyruvate aminotransferase AlaC OS=Escherichia coli (strain K12) GN=alaC PE=1 SV=1 86 418 5.0E-11
sp|P33447|ATTY_TRYCR Tyrosine aminotransferase OS=Trypanosoma cruzi PE=1 SV=2 79 418 8.0E-11
sp|Q58786|DAPAT_METJA LL-diaminopimelate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dapL PE=1 SV=1 196 411 8.0E-11
sp|Q06191|AATB_RHIML Aspartate aminotransferase B OS=Rhizobium meliloti GN=aatB PE=3 SV=1 85 461 2.0E-10
sp|P9WPZ5|DAPC_MYCTU Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapC PE=1 SV=1 84 461 2.0E-10
sp|P9WPZ4|DAPC_MYCTO Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapC PE=1 SV=1 84 461 2.0E-10
sp|Q54K95|ATTY_DICDI Tyrosine aminotransferase OS=Dictyostelium discoideum GN=tat PE=3 SV=1 115 464 2.0E-10
sp|Q9SK47|TAT3_ARATH Probable aminotransferase TAT3 OS=Arabidopsis thaliana GN=TAT3 PE=2 SV=1 109 462 4.0E-10
sp|Q8VYP2|TAT4_ARATH Probable aminotransferase TAT4 OS=Arabidopsis thaliana GN=At4g23590 PE=2 SV=1 111 428 6.0E-10
sp|Q8YP73|DAPT2_NOSS1 LL-diaminopimelate aminotransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dapL2 PE=3 SV=1 168 386 6.0E-10
sp|Q7NDX4|DAPAT_GLOVI LL-diaminopimelate aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=dapL PE=1 SV=1 111 414 7.0E-10
sp|Q9SUR6|CORI3_ARATH Cystine lyase CORI3 OS=Arabidopsis thaliana GN=CORI3 PE=1 SV=1 111 465 7.0E-10
sp|Q4FP52|HIS8_PELUB Histidinol-phosphate aminotransferase OS=Pelagibacter ubique (strain HTCC1062) GN=hisC PE=3 SV=1 175 318 8.0E-10
sp|Q67Y55|TAT1_ARATH Probable aminotransferase TAT1 OS=Arabidopsis thaliana GN=At4g28420 PE=2 SV=1 115 464 9.0E-10
sp|Q3MDN5|DAPT2_ANAVT LL-diaminopimelate aminotransferase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dapL2 PE=3 SV=1 168 386 1.0E-09
sp|O31665|MTNE_BACSU Transaminase MtnE OS=Bacillus subtilis (strain 168) GN=mtnE PE=3 SV=1 76 386 2.0E-09
sp|Q9FN30|TAT2_ARATH Probable aminotransferase TAT2 OS=Arabidopsis thaliana GN=At5g53970 PE=2 SV=1 84 415 2.0E-08
sp|Q9ST02|NAATA_HORVU Nicotianamine aminotransferase A OS=Hordeum vulgare GN=naat-A PE=1 SV=2 115 467 2.0E-08
sp|P9WQ91|AAT_MYCTU Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aspC PE=1 SV=1 176 419 3.0E-08
sp|P9WQ90|AAT_MYCTO Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aspC PE=3 SV=1 176 419 3.0E-08
sp|P63499|AAT_MYCBO Probable aspartate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aspC PE=3 SV=1 176 419 3.0E-08
sp|Q6LX26|DAPAT_METMP LL-diaminopimelate aminotransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=dapL PE=1 SV=1 196 411 3.0E-08
sp|Q3ZXC8|DAPAT_DEHMC LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=dapL PE=3 SV=1 196 415 4.0E-08
sp|Q9ST03|NAATB_HORVU Nicotianamine aminotransferase B OS=Hordeum vulgare GN=naat-B PE=1 SV=2 115 464 4.0E-08
sp|Q06402|1A12_ARATH 1-aminocyclopropane-1-carboxylate synthase 2 OS=Arabidopsis thaliana GN=ACS2 PE=1 SV=1 120 304 4.0E-08
sp|A5FRC5|DAPAT_DEHMB LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dapL PE=3 SV=1 196 415 4.0E-08
sp|Q3Z8H5|DAPAT_DEHM1 LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dapL PE=3 SV=1 115 415 4.0E-08
sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 97 323 5.0E-08
sp|P0A961|ALAA_SHIFL Glutamate-pyruvate aminotransferase AlaA OS=Shigella flexneri GN=alaA PE=3 SV=1 100 419 8.0E-08
sp|P0A959|ALAA_ECOLI Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli (strain K12) GN=alaA PE=1 SV=1 100 419 8.0E-08
sp|P0A960|ALAA_ECOL6 Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=alaA PE=3 SV=1 100 419 8.0E-08
sp|P17735|ATTY_HUMAN Tyrosine aminotransferase OS=Homo sapiens GN=TAT PE=1 SV=1 115 308 8.0E-08
sp|P04694|ATTY_RAT Tyrosine aminotransferase OS=Rattus norvegicus GN=Tat PE=1 SV=1 115 308 1.0E-07
sp|Q8QZR1|ATTY_MOUSE Tyrosine aminotransferase OS=Mus musculus GN=Tat PE=1 SV=1 115 308 2.0E-07
sp|P71348|ALAA_HAEIN Glutamate-pyruvate aminotransferase AlaA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=alaA PE=3 SV=1 100 311 3.0E-07
sp|O87320|AATC_RHIME Putative aminotransferase AatC OS=Rhizobium meliloti (strain 1021) GN=aatC PE=3 SV=2 84 418 3.0E-07
sp|Q9SAR0|1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 120 318 4.0E-07
sp|O14209|YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.04c PE=3 SV=1 110 458 5.0E-07
sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 120 319 6.0E-07
sp|P34037|HIS8_ZYMMO Histidinol-phosphate aminotransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisC PE=3 SV=3 93 390 2.0E-06
sp|Q824A4|DAPAT_CHLCV LL-diaminopimelate aminotransferase OS=Chlamydophila caviae (strain GPIC) GN=dapL PE=3 SV=1 111 415 2.0E-06
sp|Q253K9|DAPAT_CHLFF LL-diaminopimelate aminotransferase OS=Chlamydophila felis (strain Fe/C-56) GN=dapL PE=3 SV=1 111 415 2.0E-06
sp|Q8TH25|HIS8_PYRFU Histidinol-phosphate aminotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisC PE=3 SV=1 123 363 2.0E-06
sp|Q5L6M0|DAPAT_CHLAB LL-diaminopimelate aminotransferase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dapL PE=3 SV=1 111 402 4.0E-06
sp|Q82FJ1|PATR_STRAW Putative phenylalanine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pat PE=3 SV=1 184 436 4.0E-06
sp|B0BC25|DAPAT_CHLTB LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dapL PE=3 SV=1 110 449 5.0E-06
sp|B0B7W0|DAPAT_CHLT2 LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dapL PE=3 SV=1 110 449 5.0E-06
sp|Q7A875|NORG_STAAN HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain N315) GN=norG PE=3 SV=1 147 418 7.0E-06
sp|Q99XA5|NORG_STAAM HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norG PE=3 SV=1 147 418 7.0E-06
sp|A1S6Z2|HIS8_SHEAM Histidinol-phosphate aminotransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=hisC PE=3 SV=1 159 309 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0019842 vitamin binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1015
MGSGRKFSINRHTGVPKPMMRRFSNVEPSANEVQSKVHRQFRNAHEGHMPHAGLDASRSSTGVVWCTERAAEYGF
LEEPEEWANLGQGAPEVEDDIAGCFKRPETITISVTAREYGPTAGIRPLREAVANLYNEMHRKGKKSLYTWENVA
IVPGGRAGLIRIAAVLGNSYLSFFLPDYTAYNEMLSLFKNFAAIPVPLSEEDGYHIHPNKIAEEIARGTSVILTS
NPRNPTGRVVANPELAEIQDICRDRATFISDEFYSGYNYTSNCDGSTISAAENVEDVDEDDVLIIDGLTKRFRLP
GWRISWILGPKEYISAIGSCGSYLDGGACHAFQEAAIPMLEPSLVHKEMVCLQRHFRDKRDFVVRRLREMGFVIK
YVPDSTFYLWLNLEGLPDAISDGLNFFQACLEEKVIVVPGIFFDLNPSRRRDLFDSPCHHFVRFSYGPRLDVLSK
GLDGIERVVNRHKKAAS*
Coding >OphauB2|1015
ATGGGAAGCGGACGCAAATTTTCCATCAACCGGCACACGGGAGTGCCCAAGCCCATGATGCGGCGCTTTAGCAAC
GTGGAGCCGTCGGCAAACGAGGTGCAGTCCAAGGTGCACCGGCAGTTCCGCAACGCGCACGAGGGTCACATGCCT
CATGCCGGGCTGGATGCCAGCCGGTCGTCAACGGGCGTGGTGTGGTGCACAGAGCGTGCTGCCGAATACGGCTTC
CTGGAAGAGCCTGAGGAATGGGCCAACCTGGGCCAGGGCGCTCCCGAAGTCGAGGACGACATTGCCGGCTGCTTC
AAGCGCCCAGAGACAATCACGATATCGGTTACGGCGCGAGAGTACGGGCCCACGGCAGGCATCCGTCCCCTGCGT
GAGGCCGTGGCCAACTTGTACAATGAGATGCACCGCAAGGGAAAGAAGAGTTTGTATACGTGGGAAAACGTGGCC
ATTGTGCCTGGTGGCCGCGCCGGGCTGATTCGCATCGCTGCTGTGCTGGGCAATTCGTATCTGAGCTTTTTCCTG
CCCGACTACACGGCCTACAACGAGATGCTGAGTCTGTTTAAGAATTTTGCCGCCATTCCGGTTCCGCTGTCAGAA
GAGGACGGTTACCACATCCATCCCAACAAGATTGCCGAGGAAATCGCTCGCGGTACCTCTGTCATTTTGACGTCG
AACCCGCGCAACCCAACCGGACGTGTTGTTGCCAATCCTGAGCTGGCTGAGATTCAGGACATTTGCCGCGACCGC
GCCACCTTTATCAGCGACGAGTTCTACTCGGGCTACAACTACACGAGCAATTGCGACGGCAGCACCATCTCGGCG
GCGGAAAACGTGGAGGATGTGGATGAGGACGACGTGCTCATCATTGATGGCCTGACGAAGCGCTTCAGGCTGCCT
GGCTGGAGGATATCATGGATCCTTGGACCCAAGGAATATATTAGCGCCATCGGCTCGTGCGGTAGCTACCTCGAC
GGCGGTGCCTGCCATGCCTTCCAGGAGGCGGCCATCCCCATGCTGGAGCCGAGTCTAGTACACAAGGAAATGGTG
TGCCTGCAGCGACACTTTCGGGACAAGCGTGATTTCGTTGTAAGACGGCTGCGTGAGATGGGCTTTGTCATCAAA
TATGTGCCCGATTCAACCTTTTACCTGTGGCTCAATCTCGAGGGGCTTCCCGATGCCATTTCTGACGGGCTCAAC
TTCTTCCAGGCATGCCTGGAAGAAAAGGTGATTGTGGTGCCGGGCATTTTCTTTGACCTCAACCCGTCGCGGCGC
CGCGACCTATTTGACAGCCCGTGCCACCACTTTGTGCGCTTCTCGTACGGGCCGCGGCTCGACGTGCTGAGCAAG
GGACTCGACGGCATTGAGCGCGTCGTCAATCGCCACAAAAAGGCTGCATCCTGA
Transcript >OphauB2|1015
ATGGGAAGCGGACGCAAATTTTCCATCAACCGGCACACGGGAGTGCCCAAGCCCATGATGCGGCGCTTTAGCAAC
GTGGAGCCGTCGGCAAACGAGGTGCAGTCCAAGGTGCACCGGCAGTTCCGCAACGCGCACGAGGGTCACATGCCT
CATGCCGGGCTGGATGCCAGCCGGTCGTCAACGGGCGTGGTGTGGTGCACAGAGCGTGCTGCCGAATACGGCTTC
CTGGAAGAGCCTGAGGAATGGGCCAACCTGGGCCAGGGCGCTCCCGAAGTCGAGGACGACATTGCCGGCTGCTTC
AAGCGCCCAGAGACAATCACGATATCGGTTACGGCGCGAGAGTACGGGCCCACGGCAGGCATCCGTCCCCTGCGT
GAGGCCGTGGCCAACTTGTACAATGAGATGCACCGCAAGGGAAAGAAGAGTTTGTATACGTGGGAAAACGTGGCC
ATTGTGCCTGGTGGCCGCGCCGGGCTGATTCGCATCGCTGCTGTGCTGGGCAATTCGTATCTGAGCTTTTTCCTG
CCCGACTACACGGCCTACAACGAGATGCTGAGTCTGTTTAAGAATTTTGCCGCCATTCCGGTTCCGCTGTCAGAA
GAGGACGGTTACCACATCCATCCCAACAAGATTGCCGAGGAAATCGCTCGCGGTACCTCTGTCATTTTGACGTCG
AACCCGCGCAACCCAACCGGACGTGTTGTTGCCAATCCTGAGCTGGCTGAGATTCAGGACATTTGCCGCGACCGC
GCCACCTTTATCAGCGACGAGTTCTACTCGGGCTACAACTACACGAGCAATTGCGACGGCAGCACCATCTCGGCG
GCGGAAAACGTGGAGGATGTGGATGAGGACGACGTGCTCATCATTGATGGCCTGACGAAGCGCTTCAGGCTGCCT
GGCTGGAGGATATCATGGATCCTTGGACCCAAGGAATATATTAGCGCCATCGGCTCGTGCGGTAGCTACCTCGAC
GGCGGTGCCTGCCATGCCTTCCAGGAGGCGGCCATCCCCATGCTGGAGCCGAGTCTAGTACACAAGGAAATGGTG
TGCCTGCAGCGACACTTTCGGGACAAGCGTGATTTCGTTGTAAGACGGCTGCGTGAGATGGGCTTTGTCATCAAA
TATGTGCCCGATTCAACCTTTTACCTGTGGCTCAATCTCGAGGGGCTTCCCGATGCCATTTCTGACGGGCTCAAC
TTCTTCCAGGCATGCCTGGAAGAAAAGGTGATTGTGGTGCCGGGCATTTTCTTTGACCTCAACCCGTCGCGGCGC
CGCGACCTATTTGACAGCCCGTGCCACCACTTTGTGCGCTTCTCGTACGGGCCGCGGCTCGACGTGCTGAGCAAG
GGACTCGACGGCATTGAGCGCGTCGTCAATCGCCACAAAAAGGCTGCATCCTGA
Gene >OphauB2|1015
ATGGGAAGCGGACGCAAATTTTCCATCAACCGGCACACGGGAGTGCCCAAGCCCATGATGCGGCGCTTTAGCAAC
GTGGAGCCGTCGGCAAACGGTGAGGAGGACTAGATGGACGAGGCAGATGGCATGCAGCATGGCTGACAAGCAGGG
CGGCAGAGGTGCAGTCCAAGGTGCACCGGCAGTTCCGCAACGCGCACGAGGGTCACATGCCTCATGCCGGGCTGG
ATGCCAGCCGGTCGTCAACGGGCGTGGTGTGGTGCACAGAGCGTGCTGCCGAATACGGCTTCCTGGAAGAGCCTG
AGGAATGGGCCAACCTGGGCCAGGGCGCTCCCGAAGTCGAGGACGACATTGCCGGCTGCTTCAAGCGCCCAGAGA
CAATCACGATATCGGTTACGGCGCGAGAGTACGGGCCCACGGCAGGCATCCGTCCCCTGCGTGAGGCCGTGGCCA
ACTTGTACAATGAGATGCACCGCAAGGGAAAGAAGAGTTTGTATACGTGGGAAAACGTGGCCATTGTGCCTGGTG
GCCGCGCCGGGCTGATTCGCATCGCTGCTGTGCTGGGCAATTCGTATCTGAGCTTTTTCCTGCCCGACTACACGG
CCTACAACGAGATGCTGAGTCTGTTTAAGAATGCAAGTTTTTTTTTTTTTTAGTTTTTTTTTTCTCCGCTCGCTC
CTCTCTCTTCCTCTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCTCTCCCCCTCTCTCCCCCTCTCTCCCTC
TCTCTCCCTCTTCGAGTCTCTTGGGCAGATGCCTCCAGGAAAAGCACCGCGCGGCGCCACTGGGCTTGACTAATA
CCAAAAGACTTGCATCTAGTTTGCCGCCATTCCGGTTCCGCTGTCAGAAGAGGACGGTTACCACATCCATCCCAA
CAAGATTGCCGAGGAAATCGCTCGCGGTACCTCTGTCATTTTGACGTCGAACCCGCGCAACCCAACCGGACGTGT
TGTTGCCAATCCTGAGCTGGCTGAGATTCAGGACATTTGCCGCGACCGCGCCACCTTTATCAGCGACGAGTTCTA
CTCGGGCTACAACTACACGAGCAATTGCGACGGCAGCACCATCTCGGCGGCGGAAAACGTGGAGGATGTGGATGA
GGACGACGTGCTCATCATTGATGGCCTGACGAAGCGCTTCAGGCTGCCTGGCTGGAGGATATCATGGATCCTTGG
ACCCAAGGAATATATTAGCGCGTGAGCCACACCGTCTAGACTTGGCAAGGTGGACAAGTATTAATTGACACAATG
CAGCATCGGCTCGTGCGGTAGCTACCTCGACGGCGGTGCCTGCCATGCCTTCCAGGAGGCGGCCATCCCCATGCT
GGAGCCGAGTCTAGTACACAAGGAAATGGTGTGCCTGCAGCGACACTTTCGGGTAAGTTGACGCCAAGGCATACG
AGTTGCATGAGCTGACTGGTGCCACATTAGGACAAGCGTGATTTCGTTGTAAGACGGCTGCGTGAGATGGGCTTT
GTCATCAAATATGTGCCCGATTCAACCTTTTACCTGTAAGCAAAGACAGCAGCTGTGCCTCGTCATTTCAAGCTG
ACGCTGTGCACCCCAGGTGGCTCAATCTCGAGGGGCTTCCCGATGCCATTTCTGACGGGCTCAACTTCTTCCAGG
CATGCCTGGAAGAAAAGGTGATTGTGGTGCCGGGCATTTTCTTTGACCTCAACCCGTCGCGGCGCCGCGACCTAT
TTGACAGCCCGTGCCACCACTTTGTGCGCTTCTCGTACGGGCCGCGGCTCGACGTGCTGAGCAAGGGACTCGACG
GCATTGAGCGCGTCGTCAATCGCCACAAAAAGGCTGCATCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail