Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1011
Gene name
LocationContig_122:35435..38338
Strand-
Gene length (bp)2903
Transcript length (bp)2730
Coding sequence length (bp)2730
Protein length (aa) 910

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02867 Ribonuc_red_lgC Ribonucleotide reductase, barrel domain 8.0E-199 216 739
PF00317 Ribonuc_red_lgN Ribonucleotide reductase, all-alpha domain 1.1E-22 142 212
PF03477 ATP-cone ATP cone domain 6.1E-16 1 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21524|RIR1_YEAST Ribonucleoside-diphosphate reductase large chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR1 PE=1 SV=2 1 909 0.0E+00
sp|Q9UW15|RIR1_NEUCR Ribonucleoside-diphosphate reductase large chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnr-1 PE=1 SV=2 1 909 0.0E+00
sp|Q7T6Y8|RIR1_MIMIV Ribonucleoside-diphosphate reductase large subunit OS=Acanthamoeba polyphaga mimivirus GN=RNR1 PE=3 SV=2 7 769 0.0E+00
sp|Q8SR37|RIR1_ENCCU Ribonucleoside-diphosphate reductase large chain OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_0920 PE=3 SV=1 9 756 0.0E+00
sp|O15909|RIR1_TRYBB Ribonucleoside-diphosphate reductase large subunit OS=Trypanosoma brucei brucei GN=RNR1 PE=2 SV=1 3 759 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21524|RIR1_YEAST Ribonucleoside-diphosphate reductase large chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR1 PE=1 SV=2 1 909 0.0E+00
sp|Q9UW15|RIR1_NEUCR Ribonucleoside-diphosphate reductase large chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnr-1 PE=1 SV=2 1 909 0.0E+00
sp|Q7T6Y8|RIR1_MIMIV Ribonucleoside-diphosphate reductase large subunit OS=Acanthamoeba polyphaga mimivirus GN=RNR1 PE=3 SV=2 7 769 0.0E+00
sp|Q8SR37|RIR1_ENCCU Ribonucleoside-diphosphate reductase large chain OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_0920 PE=3 SV=1 9 756 0.0E+00
sp|O15909|RIR1_TRYBB Ribonucleoside-diphosphate reductase large subunit OS=Trypanosoma brucei brucei GN=RNR1 PE=2 SV=1 3 759 0.0E+00
sp|P50647|RIR1_PLAFG Ribonucleoside-diphosphate reductase large subunit OS=Plasmodium falciparum (isolate FCR-3 / Gambia) GN=RNR1 PE=3 SV=1 1 761 0.0E+00
sp|O61065|RIR1_CRYPV Ribonucleoside-diphosphate reductase large chain OS=Cryptosporidium parvum GN=RNR1 PE=3 SV=2 1 759 0.0E+00
sp|P50648|RIR1_PLAF4 Ribonucleoside-diphosphate reductase large subunit OS=Plasmodium falciparum (isolate Dd2) GN=RNR1 PE=2 SV=1 1 761 0.0E+00
sp|Q54Q71|RIR1_DICDI Ribonucleoside-diphosphate reductase large subunit OS=Dictyostelium discoideum GN=rnrA PE=3 SV=1 1 754 0.0E+00
sp|P32984|RIR1_VAR67 Ribonucleoside-diphosphate reductase large subunit OS=Variola virus (isolate Human/India/Ind3/1967) GN=I4L PE=2 SV=1 1 759 0.0E+00
sp|P12848|RIR1_VACCW Ribonucleoside-diphosphate reductase large subunit OS=Vaccinia virus (strain Western Reserve) GN=VACWR073 PE=1 SV=1 1 759 0.0E+00
sp|Q76RD8|RIR1_VACCA Ribonucleoside-diphosphate reductase large subunit OS=Vaccinia virus (strain Ankara) GN=MVA065L PE=2 SV=1 1 759 0.0E+00
sp|P36602|RIR1_SCHPO Ribonucleoside-diphosphate reductase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc22 PE=1 SV=2 1 795 0.0E+00
sp|P20503|RIR1_VACCC Ribonucleoside-diphosphate reductase large subunit OS=Vaccinia virus (strain Copenhagen) GN=I4L PE=2 SV=1 1 759 0.0E+00
sp|P21672|RIR3_YEAST Ribonucleoside-diphosphate reductase large chain 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR3 PE=1 SV=4 1 909 0.0E+00
sp|P07742|RIR1_MOUSE Ribonucleoside-diphosphate reductase large subunit OS=Mus musculus GN=Rrm1 PE=1 SV=2 1 758 0.0E+00
sp|P23921|RIR1_HUMAN Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens GN=RRM1 PE=1 SV=1 1 758 0.0E+00
sp|Q5R919|RIR1_PONAB Ribonucleoside-diphosphate reductase large subunit OS=Pongo abelii GN=RRM1 PE=2 SV=1 1 758 0.0E+00
sp|P79732|RIR1_DANRE Ribonucleoside-diphosphate reductase large subunit OS=Danio rerio GN=rrm1 PE=2 SV=1 1 768 0.0E+00
sp|Q9SJ20|RIR1_ARATH Ribonucleoside-diphosphate reductase large subunit OS=Arabidopsis thaliana GN=RNR1 PE=1 SV=1 1 759 0.0E+00
sp|Q03604|RIR1_CAEEL Ribonucleoside-diphosphate reductase large subunit OS=Caenorhabditis elegans GN=rnr-1 PE=3 SV=1 2 760 0.0E+00
sp|P48591|RIR1_DROME Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster GN=RnrL PE=1 SV=2 1 773 0.0E+00
sp|P0C8H8|RIR1_ASFP4 Ribonucleoside-diphosphate reductase large subunit OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-057 PE=3 SV=1 41 739 1.0E-170
sp|P0C8H9|RIR1_ASFWA Ribonucleoside-diphosphate reductase large subunit OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-055 PE=3 SV=1 41 739 7.0E-170
sp|P42491|RIR1_ASFB7 Ribonucleoside-diphosphate reductase large subunit OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-045 PE=3 SV=1 41 739 1.0E-169
sp|P0C8H7|RIR1_ASFK5 Ribonucleoside-diphosphate reductase large subunit OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-057 PE=3 SV=1 39 739 5.0E-169
sp|P26685|RIR1_ASFM2 Ribonucleoside-diphosphate reductase large subunit OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-053 PE=3 SV=1 39 739 1.0E-167
sp|Q9PL93|RIR1_CHLMU Ribonucleoside-diphosphate reductase subunit alpha OS=Chlamydia muridarum (strain MoPn / Nigg) GN=nrdA PE=3 SV=1 3 754 3.0E-158
sp|O84834|RIR1_CHLTR Ribonucleoside-diphosphate reductase subunit alpha OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=nrdA PE=3 SV=2 3 754 1.0E-157
sp|Q9Z6S5|RIR1_CHLPN Ribonucleoside-diphosphate reductase subunit alpha OS=Chlamydia pneumoniae GN=nrdA PE=3 SV=1 3 754 6.0E-151
sp|Q6R7H4|RIR1_OSHVF Ribonucleoside-diphosphate reductase large subunit OS=Ostreid herpesvirus 1 (isolate France) PE=3 SV=1 70 741 5.0E-147
sp|O66503|RIR1_AQUAE Ribonucleoside-diphosphate reductase subunit alpha OS=Aquifex aeolicus (strain VF5) GN=nrdA PE=3 SV=1 1 745 3.0E-116
sp|Q9ZLF9|RIR1_HELPJ Ribonucleoside-diphosphate reductase subunit alpha OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nrdA PE=3 SV=1 3 755 8.0E-108
sp|P55982|RIR1_HELPY Ribonucleoside-diphosphate reductase subunit alpha OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nrdA PE=3 SV=1 3 755 1.0E-107
sp|O83972|RIR1_TREPA Ribonucleoside-diphosphate reductase subunit alpha OS=Treponema pallidum (strain Nichols) GN=nrdA PE=3 SV=1 139 744 1.0E-96
sp|P37426|RIR1_SALTY Ribonucleoside-diphosphate reductase 1 subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nrdA PE=3 SV=1 1 750 1.0E-83
sp|P74240|RIR1_SYNY3 Ribonucleoside-diphosphate reductase subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrdA PE=3 SV=1 3 642 1.0E-83
sp|P50642|RIR1_EHV4 Ribonucleoside-diphosphate reductase large subunit OS=Equine herpesvirus 4 (strain 1942) PE=3 SV=1 152 745 3.0E-81
sp|P00452|RIR1_ECOLI Ribonucleoside-diphosphate reductase 1 subunit alpha OS=Escherichia coli (strain K12) GN=nrdA PE=1 SV=2 1 750 1.0E-80
sp|P50646|RIR1_BHV1C Ribonucleoside-diphosphate reductase large subunit OS=Bovine herpesvirus 1.1 (strain Cooper) GN=UL39 PE=3 SV=1 152 752 6.0E-80
sp|P50643|RIR1_SUHVK Ribonucleoside-diphosphate reductase large subunit OS=Suid herpesvirus 1 (strain Kaplan) GN=RR1 PE=3 SV=1 181 752 3.0E-78
sp|Q77MS1|RIR1_GAHVM Ribonucleoside-diphosphate reductase large subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV052 PE=3 SV=1 193 756 4.0E-78
sp|P43754|RIR1_HAEIN Ribonucleoside-diphosphate reductase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nrdA PE=3 SV=1 1 754 7.0E-78
sp|P89462|RIR1_HHV2H Ribonucleoside-diphosphate reductase large subunit OS=Human herpesvirus 2 (strain HG52) GN=UL39 PE=3 SV=1 121 754 2.0E-77
sp|P08543|RIR1_HHV11 Ribonucleoside-diphosphate reductase large subunit OS=Human herpesvirus 1 (strain 17) GN=UL39 PE=3 SV=2 121 745 2.0E-77
sp|P57276|RIR1_BUCAI Ribonucleoside-diphosphate reductase subunit alpha OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nrdA PE=3 SV=1 1 743 7.0E-77
sp|Q6UDJ2|RIR1_PSHV1 Ribonucleoside-diphosphate reductase large subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL39 PE=3 SV=1 202 745 9.0E-77
sp|Q89AS4|RIR1_BUCBP Ribonucleoside-diphosphate reductase subunit alpha OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nrdA PE=3 SV=1 1 770 2.0E-76
sp|P09853|RIR1_HHV23 Ribonucleoside-diphosphate reductase large subunit OS=Human herpesvirus 2 (strain 333) PE=3 SV=2 121 754 2.0E-76
sp|P28846|RIR1_EHV1B Ribonucleoside-diphosphate reductase large subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=21 PE=3 SV=1 152 745 4.0E-76
sp|Q8K9W3|RIR1_BUCAP Ribonucleoside-diphosphate reductase subunit alpha OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nrdA PE=3 SV=1 1 746 1.0E-74
sp|P32282|RIR1_BPT4 Ribonucleoside-diphosphate reductase subunit alpha OS=Enterobacteria phage T4 GN=NRDA PE=3 SV=1 22 754 1.0E-70
sp|Q4JQV6|RIR1_VZVO Ribonucleoside-diphosphate reductase large subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF19 PE=3 SV=1 152 746 2.0E-70
sp|P09248|RIR1_VZVD Ribonucleoside-diphosphate reductase large subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF19 PE=3 SV=1 152 746 2.0E-70
sp|Q6GZT8|RIR1_FRG3G Putative ribonucleoside-diphosphate reductase large subunit OS=Frog virus 3 (isolate Goorha) GN=FV3-038R PE=3 SV=1 191 745 1.0E-62
sp|Q01037|RIR1_SHV21 Ribonucleoside-diphosphate reductase large subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=61 PE=3 SV=1 190 751 2.0E-56
sp|Q2HR67|RIR1_HHV8P Ribonucleoside-diphosphate reductase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF61 PE=3 SV=1 137 743 3.0E-56
sp|Q66663|RIR1_EHV2 Ribonucleoside-diphosphate reductase large subunit OS=Equine herpesvirus 2 (strain 86/87) GN=61 PE=3 SV=1 190 743 3.0E-55
sp|P9WH77|NRDZ_MYCTU Vitamin B12-dependent ribonucleoside-diphosphate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nrdZ PE=1 SV=2 179 764 3.0E-55
sp|P9WH76|NRDZ_MYCTO Vitamin B12-dependent ribonucleoside-diphosphate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nrdZ PE=2 SV=1 179 739 5.0E-55
sp|Q9HI70|NDRZ_THEAC Vitamin B12-dependent ribonucleoside-diphosphate reductase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1475 PE=1 SV=2 191 714 3.0E-54
sp|O36411|RIR1_ALHV1 Ribonucleoside-diphosphate reductase large subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=61 PE=3 SV=1 193 779 4.0E-54
sp|P0CH00|RIR1B_MYCS2 Ribonucleoside-diphosphate reductase subunit alpha 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nrdE2 PE=1 SV=1 104 746 3.0E-53
sp|P0CG99|RIR1A_MYCS2 Ribonucleoside-diphosphate reductase subunit alpha 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nrdE1 PE=1 SV=1 104 746 3.0E-53
sp|P9WH75|RIR1_MYCTU Ribonucleoside-diphosphate reductase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nrdE PE=1 SV=1 154 746 6.0E-50
sp|P9WH74|RIR1_MYCTO Ribonucleoside-diphosphate reductase subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nrdE PE=3 SV=1 154 746 6.0E-50
sp|P0A5W9|RIR1_MYCBO Ribonucleoside-diphosphate reductase subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nrdE PE=1 SV=1 154 746 6.0E-50
sp|Q3KSU5|RIR1_EBVG Ribonucleoside-diphosphate reductase large subunit OS=Epstein-Barr virus (strain GD1) GN=BORF2 PE=3 SV=1 172 746 8.0E-49
sp|Q196Z5|RIR1_IIV3 Ribonucleoside-diphosphate reductase large subunit OS=Invertebrate iridescent virus 3 GN=IIV3-065R PE=3 SV=1 139 743 9.0E-49
sp|P03190|RIR1_EBVB9 Ribonucleoside-diphosphate reductase large subunit OS=Epstein-Barr virus (strain B95-8) GN=BORF2 PE=3 SV=1 172 746 9.0E-49
sp|P0C702|RIR1_EBVA8 Ribonucleoside-diphosphate reductase large subunit OS=Epstein-Barr virus (strain AG876) GN=BORF2 PE=3 SV=1 172 746 9.0E-49
sp|P78027|RIR1_MYCPN Ribonucleoside-diphosphate reductase subunit alpha OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=nrdE PE=3 SV=1 116 743 1.0E-48
sp|P50620|RIR1_BACSU Ribonucleoside-diphosphate reductase subunit alpha OS=Bacillus subtilis (strain 168) GN=nrdE PE=3 SV=1 162 743 2.0E-48
sp|P47473|RIR1_MYCGE Ribonucleoside-diphosphate reductase subunit alpha OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=nrdE PE=3 SV=1 116 629 1.0E-46
sp|Q9CBQ0|RIR1_MYCLE Ribonucleoside-diphosphate reductase subunit alpha OS=Mycobacterium leprae (strain TN) GN=nrdE PE=3 SV=2 154 746 3.0E-46
sp|P39452|RIR3_ECOLI Ribonucleoside-diphosphate reductase 2 subunit alpha OS=Escherichia coli (strain K12) GN=nrdE PE=2 SV=3 141 746 8.0E-46
sp|Q08698|RIR3_SALTY Ribonucleoside-diphosphate reductase 2 subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nrdE PE=1 SV=2 141 746 6.0E-45
sp|Q6MNP6|NRDJ_BDEBA Vitamin B12-dependent ribonucleotide reductase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nrdJ PE=3 SV=1 212 751 6.0E-37
sp|E7FHX6|NDRZ_PYRFU Vitamin B12-dependent ribonucleoside-diphosphate reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnr PE=1 SV=1 440 734 1.0E-34
sp|Q82KE2|NRDJ_STRAW Vitamin B12-dependent ribonucleotide reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nrdJ PE=3 SV=1 195 739 2.0E-32
sp|O54196|NRDJ_STRC2 Vitamin B12-dependent ribonucleotide reductase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=nrdJ PE=2 SV=2 195 739 3.0E-32
sp|O69981|NRDJ_STRCO Vitamin B12-dependent ribonucleotide reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nrdJ PE=2 SV=1 195 739 4.0E-32
sp|O31875|NRDEB_BACSU Ribonucleoside-diphosphate reductase NrdEB subunit alpha OS=Bacillus subtilis (strain 168) GN=nrdEB PE=3 SV=2 67 429 7.0E-32
sp|O64173|NRDEB_BPSPB Ribonucleoside-diphosphate reductase nrdEB subunit alpha OS=Bacillus phage SPbeta GN=bnrdE PE=3 SV=1 67 429 7.0E-32
sp|O55716|RIR1_IIV6 Ribonucleoside-diphosphate reductase large subunit OS=Invertebrate iridescent virus 6 GN=IIV6-085L PE=3 SV=1 429 764 3.0E-31
sp|Q7UI46|NRDJ_RHOBA Vitamin B12-dependent ribonucleotide reductase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=nrdJ PE=3 SV=1 213 756 6.0E-30
sp|O55716|RIR1_IIV6 Ribonucleoside-diphosphate reductase large subunit OS=Invertebrate iridescent virus 6 GN=IIV6-085L PE=3 SV=1 132 429 3.0E-20
sp|Q8F3P1|NRDJ_LEPIN Vitamin B12-dependent ribonucleotide reductase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=nrdJ PE=3 SV=2 212 554 4.0E-20
sp|Q72S00|NRDJ_LEPIC Vitamin B12-dependent ribonucleotide reductase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=nrdJ PE=3 SV=2 212 554 4.0E-20
sp|Q06A28|RIR1_MUHVS Viral inhibitor of RIP activation OS=Murid herpesvirus 1 (strain Smith) GN=M45 PE=1 SV=1 299 738 7.0E-17
sp|P50641|RIR1_HHV7J Ribonucleoside-diphosphate reductase large subunit-like protein U28 OS=Human herpesvirus 7 (strain JI) GN=U28 PE=3 SV=1 170 640 6.0E-14
sp|Q9QJ39|RIR1_HHV6Z Ribonucleoside-diphosphate reductase large subunit-like protein U28 OS=Human herpesvirus 6B (strain Z29) GN=U28 PE=3 SV=1 297 629 3.0E-13
sp|Q8UEM4|NRDJ_AGRFC Vitamin B12-dependent ribonucleotide reductase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nrdJ PE=3 SV=1 334 646 6.0E-13
sp|P52343|RIR1_HHV6U Ribonucleoside-diphosphate reductase large subunit-like protein U28 OS=Human herpesvirus 6A (strain Uganda-1102) GN=U28 PE=1 SV=1 297 629 2.0E-12
sp|Q89MB9|NRDJ_BRADU Vitamin B12-dependent ribonucleotide reductase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nrdJ PE=3 SV=1 334 673 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0004748 ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016728 oxidoreductase activity, acting on CH or CH2 groups, disulfide as acceptor No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0061731 ribonucleoside-diphosphate reductase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016491 oxidoreductase activity No
GO:0016725 oxidoreductase activity, acting on CH or CH2 groups No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1011
MYVRKRDGRQERVQFDKITARVSRLCYGLDADHVDPVAITQKVISGVYGGVTTIQLDDLAAETAAYMTVTHPDYA
ILAARIAVSNLHKQTKKQFSSVVSDLYHYINPKNNRPSPMISKETYECVMRHKADFDGAIVFERDFNYQYFGFKT
LERSYLLKLDGKIVERPQHMIMRVAVGIWGDNIPRVIETYDYMSNKFFTHASPTLFNAGTPQPQLSSCFLVDMKQ
DSIEGIYDTLKTCAMISKMAGGIGLNVHRIRATGSYIAGTNGTSNGVVPMLRVFNNTARYVDQGGNKRPGAFAIY
LEPWHADVFEFLDLRKNHGKEEVRARDLFLALWIPDLFMKRVEKNGDWTLMCPNECPGLADCYGEEFEALYEKYE
REGRGRRTIRAQKLWYSILEAQTETGNPFMLYKDHCNRKSNQKNLGTIRSSNLCTEIIEYCAPDEVAVCNLASLA
LPSFVNYKEGGYDFLKLHEVTQVVVRNLNKIIDVNHYPVPEARNSNMRHRPIGVGVQGLADAFLALRLPFESPEA
QQLNKQIFETIYHAALTASVELAKEEGPYSTFKGSPASEGILQFDMWNVKPSDLWDWESLREEVKTHGIRNSLLL
APMPTASTSQILGNNECFEPYTSNIYQRRVLAGEFQVVNPWLLRDLVDLNLWSDNMKNRIIAENGSVQNIPNIPK
DIKALYKTVWEVSQRHVVQMAADRGAFIDQSQSLNIHMKDPSMGKITSMHFTGWKLGLKTGMYYLRTQAAAAPIQ
FTVDQQALQVADTNTGKEKLPRKRTAPAGSSYLSSPSASRAVLYNGEMGSPEGSMAALPATTSRVVVQESALKPR
PIVVAAEKQTVIKADVPPSDSPKVLPTGPSDVQIKGDELAEPQEGETDVQAEDVESAERERDIYSDAVLACSIDN
PEACVMCSG*
Coding >OphauB2|1011
ATGTACGTCCGGAAGCGTGATGGACGTCAAGAGCGTGTTCAGTTTGACAAGATTACCGCACGGGTCTCGAGGCTC
TGTTATGGCCTCGACGCCGACCATGTCGACCCTGTAGCCATTACCCAAAAGGTTATTTCAGGCGTCTACGGCGGC
GTGACGACAATTCAGTTGGACGATTTGGCTGCCGAAACTGCCGCCTATATGACAGTCACCCATCCAGACTATGCC
ATTCTCGCTGCCCGCATTGCTGTGTCCAACCTGCACAAGCAAACAAAGAAACAGTTCTCGTCTGTAGTCAGTGAT
CTCTATCACTATATTAACCCCAAGAACAACCGCCCATCGCCAATGATCTCCAAGGAGACGTACGAGTGTGTCATG
CGGCACAAGGCAGACTTTGACGGCGCCATTGTCTTTGAGCGCGATTTCAACTACCAATACTTTGGCTTCAAGACT
CTGGAGCGCTCATACCTGCTCAAGCTAGATGGAAAGATTGTCGAGCGCCCTCAGCACATGATCATGCGTGTAGCA
GTGGGCATCTGGGGAGACAACATTCCGCGCGTCATTGAGACGTACGACTACATGTCCAACAAGTTTTTTACTCAC
GCCTCGCCCACTCTTTTCAATGCTGGCACTCCTCAGCCGCAACTCTCGTCGTGCTTCCTCGTCGACATGAAGCAG
GACAGCATCGAAGGCATCTACGATACCCTCAAAACGTGTGCCATGATTTCTAAAATGGCAGGTGGCATCGGTCTC
AATGTTCATCGCATCCGTGCCACCGGATCCTACATTGCAGGCACAAATGGCACCTCGAACGGTGTCGTCCCAATG
CTCCGAGTTTTCAACAACACTGCTCGCTACGTCGACCAAGGCGGCAACAAGCGACCTGGCGCCTTTGCCATATAT
CTAGAGCCCTGGCATGCCGACGTCTTTGAGTTTTTAGACTTGCGCAAGAATCACGGCAAAGAGGAGGTGCGCGCT
CGTGACCTGTTCCTCGCCCTCTGGATCCCGGATCTGTTCATGAAGCGTGTTGAAAAGAACGGCGATTGGACCCTC
ATGTGCCCCAATGAATGCCCTGGCCTGGCTGACTGCTATGGCGAAGAGTTCGAGGCACTGTACGAAAAGTATGAG
CGCGAAGGCCGAGGCCGCAGGACCATCCGTGCCCAGAAGCTCTGGTACTCGATTCTCGAGGCTCAGACAGAAACG
GGCAACCCCTTTATGCTCTACAAGGACCATTGCAATCGCAAGAGCAACCAAAAGAACCTGGGTACCATTCGCAGC
TCCAATCTGTGCACTGAAATCATTGAGTACTGCGCCCCAGATGAAGTTGCTGTTTGCAATCTGGCCTCACTGGCC
TTGCCCTCGTTTGTTAATTACAAGGAGGGAGGTTACGATTTTTTGAAGCTGCATGAGGTCACGCAGGTTGTGGTC
CGCAACCTCAACAAGATTATTGACGTCAATCACTACCCTGTTCCCGAAGCTCGCAACAGTAACATGCGCCATCGT
CCCATCGGCGTTGGGGTTCAAGGTCTGGCCGATGCGTTTTTGGCTCTGCGGTTGCCCTTTGAGTCTCCTGAAGCC
CAGCAACTCAATAAGCAAATATTTGAGACCATTTATCACGCTGCTCTCACTGCTTCCGTCGAATTGGCCAAGGAG
GAAGGCCCATATTCGACTTTTAAAGGCTCCCCAGCCTCGGAGGGCATCCTGCAGTTTGACATGTGGAATGTGAAG
CCTTCTGACCTATGGGACTGGGAGTCGCTGCGAGAAGAGGTCAAGACGCACGGTATCCGCAACAGCTTGCTCTTG
GCACCCATGCCTACTGCCAGCACGTCTCAGATTCTGGGTAACAATGAATGCTTCGAACCCTATACGTCAAACATT
TACCAGCGGCGCGTGCTTGCTGGCGAGTTCCAGGTTGTCAATCCGTGGCTGCTCAGGGATCTTGTTGATTTGAAC
CTCTGGTCGGACAACATGAAGAACCGCATCATTGCCGAAAATGGCTCTGTGCAGAACATCCCAAACATTCCCAAG
GATATCAAGGCACTTTATAAAACAGTCTGGGAGGTGTCGCAGCGTCATGTGGTGCAGATGGCTGCCGACCGCGGC
GCCTTTATCGATCAGTCTCAGTCACTCAATATCCACATGAAAGACCCGTCCATGGGCAAAATCACGAGCATGCAC
TTTACCGGGTGGAAGCTTGGTCTCAAGACGGGCATGTACTATCTGCGCACACAGGCAGCAGCGGCCCCCATCCAG
TTCACAGTGGACCAGCAAGCTCTCCAGGTTGCCGACACCAATACAGGAAAGGAGAAGCTGCCAAGGAAGCGTACA
GCGCCAGCCGGTTCCAGCTACCTGTCATCTCCTTCAGCATCTCGCGCAGTCTTGTACAATGGCGAGATGGGCAGC
CCGGAGGGATCTATGGCCGCGCTTCCTGCTACAACATCACGCGTGGTGGTGCAAGAGTCTGCTCTCAAGCCTCGA
CCCATAGTGGTGGCGGCTGAAAAGCAGACTGTCATTAAAGCTGACGTGCCGCCAAGCGATAGTCCCAAGGTGTTA
CCAACTGGTCCGTCCGATGTTCAAATCAAGGGCGACGAGTTGGCTGAGCCTCAAGAGGGAGAGACAGATGTCCAG
GCAGAAGATGTGGAGAGCGCGGAGCGCGAACGCGACATTTATTCGGACGCTGTGCTGGCCTGTAGCATCGATAAC
CCTGAAGCCTGTGTCATGTGCAGCGGCTAA
Transcript >OphauB2|1011
ATGTACGTCCGGAAGCGTGATGGACGTCAAGAGCGTGTTCAGTTTGACAAGATTACCGCACGGGTCTCGAGGCTC
TGTTATGGCCTCGACGCCGACCATGTCGACCCTGTAGCCATTACCCAAAAGGTTATTTCAGGCGTCTACGGCGGC
GTGACGACAATTCAGTTGGACGATTTGGCTGCCGAAACTGCCGCCTATATGACAGTCACCCATCCAGACTATGCC
ATTCTCGCTGCCCGCATTGCTGTGTCCAACCTGCACAAGCAAACAAAGAAACAGTTCTCGTCTGTAGTCAGTGAT
CTCTATCACTATATTAACCCCAAGAACAACCGCCCATCGCCAATGATCTCCAAGGAGACGTACGAGTGTGTCATG
CGGCACAAGGCAGACTTTGACGGCGCCATTGTCTTTGAGCGCGATTTCAACTACCAATACTTTGGCTTCAAGACT
CTGGAGCGCTCATACCTGCTCAAGCTAGATGGAAAGATTGTCGAGCGCCCTCAGCACATGATCATGCGTGTAGCA
GTGGGCATCTGGGGAGACAACATTCCGCGCGTCATTGAGACGTACGACTACATGTCCAACAAGTTTTTTACTCAC
GCCTCGCCCACTCTTTTCAATGCTGGCACTCCTCAGCCGCAACTCTCGTCGTGCTTCCTCGTCGACATGAAGCAG
GACAGCATCGAAGGCATCTACGATACCCTCAAAACGTGTGCCATGATTTCTAAAATGGCAGGTGGCATCGGTCTC
AATGTTCATCGCATCCGTGCCACCGGATCCTACATTGCAGGCACAAATGGCACCTCGAACGGTGTCGTCCCAATG
CTCCGAGTTTTCAACAACACTGCTCGCTACGTCGACCAAGGCGGCAACAAGCGACCTGGCGCCTTTGCCATATAT
CTAGAGCCCTGGCATGCCGACGTCTTTGAGTTTTTAGACTTGCGCAAGAATCACGGCAAAGAGGAGGTGCGCGCT
CGTGACCTGTTCCTCGCCCTCTGGATCCCGGATCTGTTCATGAAGCGTGTTGAAAAGAACGGCGATTGGACCCTC
ATGTGCCCCAATGAATGCCCTGGCCTGGCTGACTGCTATGGCGAAGAGTTCGAGGCACTGTACGAAAAGTATGAG
CGCGAAGGCCGAGGCCGCAGGACCATCCGTGCCCAGAAGCTCTGGTACTCGATTCTCGAGGCTCAGACAGAAACG
GGCAACCCCTTTATGCTCTACAAGGACCATTGCAATCGCAAGAGCAACCAAAAGAACCTGGGTACCATTCGCAGC
TCCAATCTGTGCACTGAAATCATTGAGTACTGCGCCCCAGATGAAGTTGCTGTTTGCAATCTGGCCTCACTGGCC
TTGCCCTCGTTTGTTAATTACAAGGAGGGAGGTTACGATTTTTTGAAGCTGCATGAGGTCACGCAGGTTGTGGTC
CGCAACCTCAACAAGATTATTGACGTCAATCACTACCCTGTTCCCGAAGCTCGCAACAGTAACATGCGCCATCGT
CCCATCGGCGTTGGGGTTCAAGGTCTGGCCGATGCGTTTTTGGCTCTGCGGTTGCCCTTTGAGTCTCCTGAAGCC
CAGCAACTCAATAAGCAAATATTTGAGACCATTTATCACGCTGCTCTCACTGCTTCCGTCGAATTGGCCAAGGAG
GAAGGCCCATATTCGACTTTTAAAGGCTCCCCAGCCTCGGAGGGCATCCTGCAGTTTGACATGTGGAATGTGAAG
CCTTCTGACCTATGGGACTGGGAGTCGCTGCGAGAAGAGGTCAAGACGCACGGTATCCGCAACAGCTTGCTCTTG
GCACCCATGCCTACTGCCAGCACGTCTCAGATTCTGGGTAACAATGAATGCTTCGAACCCTATACGTCAAACATT
TACCAGCGGCGCGTGCTTGCTGGCGAGTTCCAGGTTGTCAATCCGTGGCTGCTCAGGGATCTTGTTGATTTGAAC
CTCTGGTCGGACAACATGAAGAACCGCATCATTGCCGAAAATGGCTCTGTGCAGAACATCCCAAACATTCCCAAG
GATATCAAGGCACTTTATAAAACAGTCTGGGAGGTGTCGCAGCGTCATGTGGTGCAGATGGCTGCCGACCGCGGC
GCCTTTATCGATCAGTCTCAGTCACTCAATATCCACATGAAAGACCCGTCCATGGGCAAAATCACGAGCATGCAC
TTTACCGGGTGGAAGCTTGGTCTCAAGACGGGCATGTACTATCTGCGCACACAGGCAGCAGCGGCCCCCATCCAG
TTCACAGTGGACCAGCAAGCTCTCCAGGTTGCCGACACCAATACAGGAAAGGAGAAGCTGCCAAGGAAGCGTACA
GCGCCAGCCGGTTCCAGCTACCTGTCATCTCCTTCAGCATCTCGCGCAGTCTTGTACAATGGCGAGATGGGCAGC
CCGGAGGGATCTATGGCCGCGCTTCCTGCTACAACATCACGCGTGGTGGTGCAAGAGTCTGCTCTCAAGCCTCGA
CCCATAGTGGTGGCGGCTGAAAAGCAGACTGTCATTAAAGCTGACGTGCCGCCAAGCGATAGTCCCAAGGTGTTA
CCAACTGGTCCGTCCGATGTTCAAATCAAGGGCGACGAGTTGGCTGAGCCTCAAGAGGGAGAGACAGATGTCCAG
GCAGAAGATGTGGAGAGCGCGGAGCGCGAACGCGACATTTATTCGGACGCTGTGCTGGCCTGTAGCATCGATAAC
CCTGAAGCCTGTGTCATGTGCAGCGGCTAA
Gene >OphauB2|1011
ATGTACGTCCGGAAGCGTGGTATGTACTGCTCAAGTCTTTTCTTCTGCGCCCAACGGCAGCTTGGCTGACGGCAC
TACCAGATGGACGTCAAGAGCGTGTTCAGTTTGACAAGATTACCGCACGGGTCTCGAGGCTCTGTTATGGCCTCG
ACGCCGACCATGTCGACCCTGTAGCCATTACCCAAAAGGTTATTTCAGGCGTCTACGGCGGCGTGACGACAATTC
AGTTGGACGATTTGGTGAGCTCTATGGCGCCGTCGTCTGGTAGCTTGATGCTAATGCTGGCTGTGTAGGCTGCCG
AAACTGCCGCCTATATGACAGTCACCCATCCAGACTATGCCATTCTCGCTGCCCGCATTGCTGTGTCCAACCTGC
ACAAGCAAACAAAGAAACAGTTCTCGTCTGTAGTCAGTGATCTCTATCACTATATTAACCCCAAGAACAACCGCC
CATCGCCAATGATCTCCAAGGAGACGTACGAGTGTGTCATGCGGCACAAGGCAGACTTTGACGGCGCCATTGTCT
TTGAGCGCGATTTCAACTACCAATACTTTGGCTTCAAGACTCTGGAGCGCTCATACCTGCTCAAGCTAGATGGAA
AGATTGTCGAGCGCCCTCAGCACATGATCATGCGTGTAGCAGTGGGCATCTGGGGAGACAACATTCCGCGCGTCA
TTGAGACGTACGACTACATGTCCAACAAGTTTTTTACTCACGCCTCGCCCACTCTTTTCAATGCTGGCACTCCTC
AGCCGCAACTCTCGTCGTGCTTCCTCGTCGACATGAAGCAGGACAGCATCGAAGGCATCTACGATACCCTCAAAA
CGTGTGCCATGATTTCTAAAATGGCAGGTGGCATCGGTCTCAATGTTCATCGCATCCGTGCCACCGGATCCTACA
TTGCAGGCACAAATGGCACCTCGAACGGTGTCGTCCCAATGCTCCGAGTTTTCAACAACACTGCTCGCTACGTCG
ACCAAGGCGGCAACAAGCGACCTGGCGCCTTTGCCATATATCTAGAGCCCTGGCATGCCGACGTCTTTGAGTTTT
TAGACTTGCGCAAGAATCACGGCAAAGAGGAGGTGCGCGCTCGTGACCTGTTCCTCGCCCTCTGGATCCCGGATC
TGTTCATGAAGCGTGTTGAAAAGAACGGCGATTGGACCCTCATGTGCCCCAATGAATGCCCTGGCCTGGCTGACT
GCTATGGCGAAGAGTTCGAGGCACTGTACGAAAAGTATGAGCGCGAAGGCCGAGGCCGCAGGACCATCCGTGCCC
AGAAGCTCTGGTACTCGATTCTCGAGGCTCAGACAGAAACGGGCAACCCCTTTATGCTCTACAAGGACCATTGCA
ATCGCAAGAGCAACCAAAAGAACCTGGGTACCATTCGCAGCTCCAATCTGTGCACTGAAATCATTGAGTACTGCG
CCCCAGATGAAGTTGCTGTTTGCAATCTGGCCTCACTGGCCTTGCCCTCGTTTGTTAATTACAAGGAGGGAGGTT
ACGATTTTTTGAAGCTGCATGAGGTCACGCAGGTTGTGGTCCGCAACCTCAACAAGATTATTGACGTCAATCACT
ACCCTGTTCCCGAAGCTCGCAACAGTAACATGCGCCATCGTCCCATCGGCGTTGGGGTTCAAGGTCTGGCCGATG
CGTTTTTGGCTCTGCGGTTGCCCTTTGAGTCTCCTGAAGCCCAGCAACTCAATAAGCAAATATTTGAGACCATTT
ATCACGCTGCTCTCACTGCTTCCGTCGAATTGGCCAAGGAGGAAGGCCCATATTCGACTTTTAAAGGCTCCCCAG
CCTCGGAGGGCATCCTGCAGTTTGACATGTGGAATGTGAAGCCTTCTGACCTATGGGACTGGGAGTCGCTGCGAG
AAGAGGTCAAGACGCACGGTATCCGCAACAGCTTGCTCTTGGCACCCATGCCTACTGCCAGCACGTCTCAGATTC
TGGGTAACAATGAATGCTTCGAACCCTATACGTCAAACATTTACCAGCGGCGCGTGCTTGCTGGCGAGTTCCAGG
TTGTCAATCCGTGGCTGCTCAGGGATCTTGTTGATTTGAACCTCTGGTCGGACAACATGAAGAACCGCATCATTG
CCGAAAATGGCTCTGTGCAGAACATCCCAAACATTCCCAAGGATATCAAGGCACTTTATAAAACAGTCTGGGAGG
TGTCGCAGCGTCATGTGGTGCAGATGGCTGCCGACCGCGGCGCCTTTATCGATCAGTCTCAGTCACTCAATATCC
ACATGAAAGACCCGTCCATGGGCAAAATCACGAGCATGCACTTTACCGGGTGGAAGCTTGGTCTCAAGACGGGCA
TGTACTATCTGCGCACACAGGCAGCAGCGGCCCCCATCCAGTTCACAGTGGACCAGCAAGCTCTCCAGGTTGCCG
ACACCAATACAGGAAAGGAGAAGCTGCCAAGGAAGCGTACAGCGCCAGCCGGTTCCAGCTACCTGTCATCTCCTT
CAGCATCTCGCGCAGTCTTGTACAATGGCGAGATGGGCAGCCCGGAGGGATCTATGGCCGCGCTTCCTGCTACAA
CATCACGCGTGGTGGTGCAAGAGTCTGCTCTCAAGCCTCGACCCATAGTGGTGGCGGCTGAAAAGCAGACTGTCA
TTAAAGCTGACGTGCCGCCAAGCGATAGTCCCAAGGTGTTACCAACTGGTCCGTCCGATGTTCAAATCAAGGGCG
ACGAGTTGGCTGAGCCTCAAGAGGGAGAGACAGATGTCCAGGCAGAAGATGTGGAGAGCGCGGAGCGCGAACGCG
ACATTTATTCGGACGCTGTGCTGGCCTGTAAGACATGTTGCACAAATCTTGGTGGCATTCTGGAAAAGTACTAAC
AAGCCACAGGTAGCATCGATAACCCTGAAGCCTGTGTCATGTGCAGCGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail