Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1010
Gene name
LocationContig_122:28684..29974
Strand-
Gene length (bp)1290
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.2E-06 21 94

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AZC5|CFMA_ARTBC GPI-anchored CFEM domain protein ARB_01545 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01545 PE=1 SV=2 1 97 2.0E-07
sp|Q4WLB9|CFMA_ASPFU GPI-anchored CFEM domain protein A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfmA PE=1 SV=1 26 94 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1010
MKSVVVALSALAVVATAQESASFPSCAQQCVSNMQQPSKAAELNCAGKENEEKTKQCLCENRNFLYGLRDCTDAV
CAKDTDTQQIVQWGVSFCKGVGVEIDPGSGPGNGNGGGNGGGNGNGNGNGNGGGNGGGNGGGNGGGNGGGNGDGN
GNGGGNGDGNGGGNGGNGNGGGNGSGGVIGGGSGSGSGSGSGSGSGDGNRGGNNGGNDGGNGNGNGNGGNGNNGG
NGNDGGNGNNSSGEGSVSTISSTMTSGTAVATTTEGGNGGNESSSEGGNGGGAGATTSGGNGGASETSNGGNGGA
SETSSGSGSSQTNGGNGGSRSSSSSNGRTSTSSGFAAQKTAAPAGMLAAAGLAALLL*
Coding >OphauB2|1010
ATGAAGTCTGTCGTTGTTGCCCTCAGCGCCTTGGCCGTGGTTGCTACGGCCCAAGAGAGCGCCTCTTTCCCCAGC
TGTGCTCAACAATGCGTCTCCAACATGCAACAGCCAAGCAAAGCCGCCGAGCTTAACTGTGCCGGAAAGGAGAAT
GAAGAAAAGACCAAGCAGTGTCTCTGCGAGAACAGGAACTTCCTTTACGGCCTCCGTGACTGCACCGATGCTGTT
TGCGCCAAGGATACTGACACCCAGCAAATTGTTCAATGGGGTGTCAGCTTCTGCAAAGGTGTCGGCGTTGAAATC
GACCCAGGCTCTGGCCCTGGCAATGGCAATGGTGGCGGTAACGGCGGCGGCAATGGAAACGGCAATGGAAACGGC
AATGGTGGCGGTAACGGTGGCGGTAACGGTGGCGGTAACGGTGGCGGCAATGGTGGCGGCAATGGTGACGGTAAC
GGCAATGGCGGCGGTAATGGTGACGGCAACGGCGGCGGCAACGGCGGCAACGGAAACGGCGGCGGTAATGGCTCC
GGCGGTGTCATCGGCGGTGGATCTGGCAGCGGATCTGGCAGCGGATCTGGCAGCGGATCCGGTGACGGAAACAGG
GGCGGAAACAATGGCGGCAATGATGGTGGCAATGGCAATGGCAATGGCAACGGCGGCAATGGCAACAACGGCGGC
AACGGCAACGATGGCGGCAACGGCAACAACTCTTCTGGCGAGGGCTCTGTCTCTACCATCTCCAGCACCATGACA
TCTGGTACTGCTGTCGCTACCACGACTGAGGGTGGCAACGGAGGCAACGAGTCTTCTTCTGAAGGTGGTAATGGT
GGCGGCGCCGGTGCTACCACCAGTGGCGGCAATGGCGGTGCCTCTGAGACTAGCAATGGAGGCAATGGCGGTGCC
TCTGAGACCAGCAGCGGCAGCGGTTCATCGCAGACGAATGGCGGCAACGGCGGTTCTCGCTCGTCGAGCTCTAGC
AATGGTCGCACTTCGACCAGCTCTGGCTTCGCTGCCCAGAAGACTGCTGCCCCTGCTGGCATGCTCGCCGCCGCC
GGTCTCGCAGCCCTTCTTTTGTAA
Transcript >OphauB2|1010
ATGAAGTCTGTCGTTGTTGCCCTCAGCGCCTTGGCCGTGGTTGCTACGGCCCAAGAGAGCGCCTCTTTCCCCAGC
TGTGCTCAACAATGCGTCTCCAACATGCAACAGCCAAGCAAAGCCGCCGAGCTTAACTGTGCCGGAAAGGAGAAT
GAAGAAAAGACCAAGCAGTGTCTCTGCGAGAACAGGAACTTCCTTTACGGCCTCCGTGACTGCACCGATGCTGTT
TGCGCCAAGGATACTGACACCCAGCAAATTGTTCAATGGGGTGTCAGCTTCTGCAAAGGTGTCGGCGTTGAAATC
GACCCAGGCTCTGGCCCTGGCAATGGCAATGGTGGCGGTAACGGCGGCGGCAATGGAAACGGCAATGGAAACGGC
AATGGTGGCGGTAACGGTGGCGGTAACGGTGGCGGTAACGGTGGCGGCAATGGTGGCGGCAATGGTGACGGTAAC
GGCAATGGCGGCGGTAATGGTGACGGCAACGGCGGCGGCAACGGCGGCAACGGAAACGGCGGCGGTAATGGCTCC
GGCGGTGTCATCGGCGGTGGATCTGGCAGCGGATCTGGCAGCGGATCTGGCAGCGGATCCGGTGACGGAAACAGG
GGCGGAAACAATGGCGGCAATGATGGTGGCAATGGCAATGGCAATGGCAACGGCGGCAATGGCAACAACGGCGGC
AACGGCAACGATGGCGGCAACGGCAACAACTCTTCTGGCGAGGGCTCTGTCTCTACCATCTCCAGCACCATGACA
TCTGGTACTGCTGTCGCTACCACGACTGAGGGTGGCAACGGAGGCAACGAGTCTTCTTCTGAAGGTGGTAATGGT
GGCGGCGCCGGTGCTACCACCAGTGGCGGCAATGGCGGTGCCTCTGAGACTAGCAATGGAGGCAATGGCGGTGCC
TCTGAGACCAGCAGCGGCAGCGGTTCATCGCAGACGAATGGCGGCAACGGCGGTTCTCGCTCGTCGAGCTCTAGC
AATGGTCGCACTTCGACCAGCTCTGGCTTCGCTGCCCAGAAGACTGCTGCCCCTGCTGGCATGCTCGCCGCCGCC
GGTCTCGCAGCCCTTCTTTTGTAA
Gene >OphauB2|1010
ATGAAGTCTGTCGTTGTTGCCCTCAGCGCCTTGGCCGTGGTTGCTACGGCCCAAGAGAGCGCCTCTTTCCCCAGC
TGTGCTGTGAGTTGCCTCTTGACTGCTCATTCAGGACTGCCACTGACCGTGCAATAGCAACAATGCGTCTCCAAC
ATGCAACAGCCAAGCAAAGCCGCCGAGCTTAACTGTGCCGGAAAGGAGAATGAAGAAAAGACCAAGCAGTGTCTC
TGCGAGAACAGGAACTTCCTTTACGGCCTCCGTGACTGCACCGATGCTGTTTGCGCCAAGGATACTGACACCCAG
CAAATTGTTCAATGGGGTGTCAGCTTCTGCAAAGGTGGGTCATCTTTTTTGAAAGTTTGCCATTGATTACGCTAA
CAATTCTTAGGTGTCGGCGTTGAAATCGACCCAGGCTCTGGCCCTGGCAATGGCAATGGTGGCGGTAACGGCGGC
GGCAATGGAAACGGCAATGGAAACGGCAATGGTGGCGGTAACGGTGGCGGTAACGGTGGCGGTAACGGTGGCGGC
AATGGTGGCGGCAATGGTGACGGTAACGGCAATGGCGGCGGTAATGGTGACGGCAACGGCGGCGGCAACGGCGGC
AACGGAAACGGCGGCGGTAATGGCTCCGGCGGTGTCATCGGCGGTGGATCTGGCAGCGGATCTGGCAGCGGATCT
GGCAGCGGATCCGGTGACGGAAACAGGGGCGGAAACAATGGCGGCAATGATGGTGGCAATGGCAATGGCAATGGC
AACGGCGGCAATGGCAACAACGGCGGCAACGGCAACGATGGCGGCAACGGCAACAACTCTTCTGGCGAGGTTAGT
ATTCTTATGTCGCAGTATTCACTTGTTTTCATGCTAATATGTCTGGTACATAGGGCTCTGTCTCTACCATCTCCA
GCACCATGACATCTGGTACTGCTGTCGCTACCACGACTGAGGGTGGCAACGGAGGCAACGAGTCTTCTTCTGAAG
GTGGTAATGGTGGCGGCGCCGGTGCTACCACCAGTGGCGGCAATGGCGGTGCCTCTGAGACTAGCAATGGAGGCA
ATGGCGGTGCCTCTGAGACCAGCAGCGGCAGCGGTTCATCGCAGACGAATGGCGGCAACGGCGGTTCTCGCTCGT
CGAGCTCTAGCAATGGTCGCACTTCGACCAGCTCTGGCTTCGCTGTAAGTTGAAACTTACTGACCACTCTCTTGG
TTCCATTCCGCTAACTGAATGTAGGCCCAGAAGACTGCTGCCCCTGCTGGCATGCTCGCCGCCGCCGGTCTCGCA
GCCCTTCTTTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail