Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|101
Gene name
LocationContig_1:258957..262035
Strand-
Gene length (bp)3078
Transcript length (bp)3078
Coding sequence length (bp)3078
Protein length (aa) 1026

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.1E-06 588 655
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.2E-07 665 730
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.7E-16 757 822
PF16842 RRM_occluded Occluded RNA-recognition motif 4.3E-24 859 935
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.5E-05 750 836

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 5 933 2.0E-71
sp|P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP24 PE=1 SV=1 576 1010 1.0E-35
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 5 843 7.0E-29
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 5 829 2.0E-28
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 5 842 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 5 933 2.0E-71
sp|P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP24 PE=1 SV=1 576 1010 1.0E-35
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 5 843 7.0E-29
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 5 829 2.0E-28
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 5 842 4.0E-26
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 5 829 1.0E-21
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 664 827 4.0E-15
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 585 827 6.0E-15
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 587 830 2.0E-14
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 587 830 2.0E-14
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 587 830 3.0E-14
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 587 830 3.0E-14
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 587 830 3.0E-14
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 662 833 5.0E-14
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 664 886 5.0E-14
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 587 830 6.0E-14
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 664 917 7.0E-14
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 664 917 8.0E-14
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 587 830 1.0E-13
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 664 927 1.0E-13
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 587 830 1.0E-13
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 662 940 2.0E-13
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 652 996 3.0E-13
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 662 991 3.0E-13
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 664 835 4.0E-13
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 664 835 5.0E-13
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 587 830 5.0E-13
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 660 927 5.0E-13
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 664 835 9.0E-13
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 664 835 9.0E-13
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 664 835 9.0E-13
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 664 989 2.0E-12
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 691 927 2.0E-12
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 587 830 2.0E-12
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 664 897 3.0E-12
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 624 917 5.0E-12
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 664 989 1.0E-11
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 664 858 1.0E-11
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 660 831 1.0E-11
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 664 927 1.0E-11
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 567 831 1.0E-11
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 664 927 2.0E-11
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 664 886 2.0E-11
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 664 827 3.0E-11
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 664 962 5.0E-11
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 664 928 1.0E-10
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 664 827 1.0E-10
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 652 940 1.0E-10
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 664 827 1.0E-10
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 587 830 2.0E-10
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 664 917 2.0E-10
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 664 827 3.0E-10
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 664 827 3.0E-10
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 664 827 3.0E-10
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 664 827 3.0E-10
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 664 827 3.0E-10
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 736 816 3.0E-10
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 664 827 3.0E-10
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 664 827 3.0E-10
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 664 827 4.0E-10
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 653 837 6.0E-10
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 664 827 8.0E-10
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 570 833 9.0E-10
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 570 833 9.0E-10
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 570 833 9.0E-10
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 570 833 9.0E-10
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 570 833 9.0E-10
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 664 827 9.0E-10
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 570 833 1.0E-09
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 664 827 1.0E-09
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 758 924 1.0E-09
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 664 837 2.0E-09
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 587 830 2.0E-09
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 664 827 2.0E-09
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 573 837 4.0E-09
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 664 835 4.0E-09
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 758 924 4.0E-09
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 664 1002 5.0E-09
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 664 831 5.0E-09
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 664 827 5.0E-09
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 573 835 6.0E-09
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 664 827 7.0E-09
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 652 826 8.0E-09
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 664 928 1.0E-08
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 664 827 1.0E-08
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 658 833 2.0E-08
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 664 819 2.0E-08
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 664 928 3.0E-08
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 658 833 3.0E-08
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 658 833 3.0E-08
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 758 924 3.0E-08
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 661 829 3.0E-08
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 664 831 3.0E-08
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 658 833 4.0E-08
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 658 833 4.0E-08
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 658 833 5.0E-08
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 658 833 5.0E-08
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 664 928 5.0E-08
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 651 831 6.0E-08
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 758 924 7.0E-08
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 664 837 8.0E-08
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 661 827 8.0E-08
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 587 831 1.0E-07
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 679 830 1.0E-07
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 661 829 1.0E-07
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 653 827 1.0E-07
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 658 835 1.0E-07
sp|Q28G87|LARP7_XENTR La-related protein 7 OS=Xenopus tropicalis GN=larp7 PE=2 SV=1 751 816 3.0E-07
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 662 827 3.0E-07
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 741 824 3.0E-07
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 741 824 4.0E-07
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 758 840 5.0E-07
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 664 923 6.0E-07
sp|Q5NVM8|RNPS1_PONAB RNA-binding protein with serine-rich domain 1 OS=Pongo abelii GN=RNPS1 PE=2 SV=1 741 824 6.0E-07
sp|Q99M28|RNPS1_MOUSE RNA-binding protein with serine-rich domain 1 OS=Mus musculus GN=Rnps1 PE=2 SV=1 741 824 6.0E-07
sp|Q4R5N1|RNPS1_MACFA RNA-binding protein with serine-rich domain 1 OS=Macaca fascicularis GN=RNPS1 PE=2 SV=1 741 824 6.0E-07
sp|Q15287|RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens GN=RNPS1 PE=1 SV=1 741 824 6.0E-07
sp|A6QR16|RNPS1_BOVIN RNA-binding protein with serine-rich domain 1 OS=Bos taurus GN=RNPS1 PE=2 SV=1 741 824 6.0E-07
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 741 824 7.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 758 899 7.0E-07
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 758 924 8.0E-07
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 664 928 9.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 664 917 1.0E-06
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 573 835 1.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 758 840 1.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 758 840 1.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 758 840 1.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 758 840 1.0E-06
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 664 928 1.0E-06
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 664 928 1.0E-06
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 705 819 1.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 758 917 1.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 758 917 1.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 758 917 1.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 758 826 1.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 761 917 1.0E-06
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 660 831 2.0E-06
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 657 833 2.0E-06
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 651 811 3.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 664 940 4.0E-06
sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=2 758 830 4.0E-06
sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 758 830 4.0E-06
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 663 841 4.0E-06
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 758 917 4.0E-06
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 758 899 4.0E-06
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 573 835 5.0E-06
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 758 917 5.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 758 917 5.0E-06
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 587 837 5.0E-06
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 654 854 6.0E-06
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 660 831 6.0E-06
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 664 820 6.0E-06
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 758 899 6.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 587 835 7.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 587 829 7.0E-06
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 758 899 7.0E-06
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 573 835 8.0E-06
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 573 835 8.0E-06
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 755 837 8.0E-06
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 755 837 8.0E-06
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 663 850 8.0E-06
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 663 850 8.0E-06
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 755 837 8.0E-06
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 755 837 9.0E-06
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 755 837 9.0E-06
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 662 827 9.0E-06
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 662 827 9.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 758 896 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|101
MAMMVGEDSWMDYLEEAARDADLEQTVHVIELYKRAIDAEPGSLGLWLAYCNYFWQLWERCQAPEATGGWSEDEQ
LMGREIFSFGAALDLWQQGYEAIKLRINDSHLLWDRWLSLEMEQLAKTKTPEGIRRITHLYRDRLLIPHVTWDHT
SQAFSTFVSEHNTSAWEETMKQVTASAQGVKRVIAARDGFELKLKQAARSQDGEAQKSIMREYLEWEMQQSKKPK
DLAEMAVDLCCGLFSRALTGVFALDEHVWLEYIVYIASVPSDCQPPKKLLDVLRRAVEHCPWSGQLWNRYILCAE
EAKLAFSEIESIKHSATSDNQLYKNGMESMIEMYVAWCGFLKRTALEATAADEAVDVADVGLRAALEDVAVVGKR
LYGKEFKGDPKFRLERIYMQYLTEKKGAIDEARTMWNKLADMKMHADSYEFWFAFYMWEMAMFSSNLPSNRSPTP
SSTGLGMRIPTDATAVLHAAATRETIDWPERILEVYLQHCNDYEQPATVRLATDTVHRVGQAVQKRRQGEEEEKA
AAYAAYYARAQQGDEETSKRKREAQADGAESESGSKRQRSDEEAGQRWRLQQSLKRDRENTSVLVRGLPGQASET
KVRQYFKDYGHINNLTAFVHDKDGSSTTALIEFGTAQEAQSALLRDKKYFGQSQISVQPGHDLTVYLANYPPTAD
DKYMRRLFKDCGEVLSVRWPSLKVNSHRRFCYVTFGERSASAKAVAKDGRLLDGKYRLLAKYSDPQQRKKREGAV
AEGREVHVTGLDRGVTAEELEQVFGKYGSVGRVNVPRTLAGKSKGFAYVDFETGEQAEQAARELNGVKLASQIIK
VAVSRETRVKPSATSTLGPSPTDTEAPSAEQIADRTIALLGLPDTVNDARVAALLDPMGPVLKLLVQPAHGGARI
EFADAAAAGRAALRLDGIDFDGHRLRVGSLDDLRRARAEQPQSRIVYGAQPVASSSSLLAPTSLTVRRPGPAAKT
PRPPPAALHRKSLPQGHADAPGAKTNQDFTRLFLATAQQKAEPNQDAEAS*
Coding >OphauB2|101
ATGGCCATGATGGTAGGCGAGGATAGCTGGATGGACTACTTGGAAGAGGCGGCGCGCGACGCCGATTTGGAGCAG
ACGGTGCATGTCATCGAGCTCTACAAGCGGGCCATTGACGCAGAGCCGGGTAGTCTTGGGCTCTGGCTGGCCTAC
TGCAACTATTTCTGGCAGCTGTGGGAGAGGTGCCAGGCCCCAGAGGCCACTGGCGGCTGGTCCGAAGATGAGCAG
CTCATGGGCCGCGAAATCTTTTCCTTTGGAGCTGCTCTGGACCTCTGGCAGCAGGGATACGAGGCGATTAAGCTG
CGCATCAATGATAGCCACTTGCTCTGGGACCGCTGGCTGAGCCTGGAAATGGAGCAACTGGCCAAGACGAAGACT
CCCGAGGGCATCCGTCGCATCACGCATTTGTACCGCGACCGTCTTCTCATTCCCCATGTTACATGGGACCACACT
TCACAGGCCTTTTCCACCTTTGTCTCGGAACACAATACGTCGGCGTGGGAAGAGACGATGAAGCAGGTGACGGCC
TCGGCGCAAGGCGTCAAGCGTGTCATTGCCGCGCGAGACGGGTTTGAGCTCAAGCTCAAGCAAGCGGCGCGCTCA
CAAGACGGCGAGGCGCAAAAGTCAATCATGAGGGAGTATCTGGAGTGGGAGATGCAGCAGAGCAAGAAGCCCAAG
GACTTGGCTGAAATGGCTGTTGATCTCTGCTGCGGCCTCTTTTCGCGTGCCCTGACGGGCGTCTTTGCGCTCGAC
GAGCATGTCTGGCTCGAGTACATTGTCTACATTGCTTCGGTTCCCTCGGACTGCCAGCCGCCCAAGAAACTGCTG
GATGTGCTGCGGCGCGCCGTGGAGCACTGTCCTTGGTCTGGCCAGCTCTGGAACAGGTACATTTTGTGTGCCGAA
GAGGCCAAGCTTGCCTTTTCGGAAATCGAGTCCATCAAGCACTCGGCAACAAGCGACAACCAGCTGTACAAGAAT
GGCATGGAGAGCATGATTGAAATGTACGTGGCGTGGTGCGGCTTTCTCAAGCGCACGGCTCTCGAGGCCACTGCG
GCCGACGAGGCGGTGGATGTGGCAGACGTTGGTCTGCGAGCAGCGCTGGAGGATGTGGCCGTGGTTGGCAAGCGG
CTCTACGGCAAGGAATTCAAGGGCGACCCCAAATTCCGGCTGGAGCGCATATACATGCAGTATCTGACGGAGAAG
AAGGGGGCGATTGACGAGGCTCGGACAATGTGGAATAAGCTGGCCGACATGAAGATGCATGCCGACAGCTACGAG
TTTTGGTTTGCCTTTTACATGTGGGAGATGGCCATGTTTTCCTCGAACCTGCCGTCGAACCGAAGCCCGACGCCG
TCGTCGACGGGGCTGGGCATGCGCATTCCCACAGACGCCACAGCAGTTTTGCACGCGGCCGCCACGCGAGAAACA
ATAGACTGGCCAGAGCGCATCCTCGAGGTGTACCTGCAGCACTGCAATGACTATGAGCAGCCAGCCACGGTGCGG
CTTGCCACGGACACGGTGCACAGGGTCGGGCAGGCGGTGCAGAAGCGGCGGCAGGGCGAGGAGGAGGAAAAGGCG
GCGGCCTATGCGGCCTACTATGCCAGAGCGCAGCAGGGCGACGAGGAGACGTCGAAGCGCAAACGGGAGGCCCAG
GCAGATGGGGCAGAGAGTGAGAGCGGCAGCAAGCGGCAGCGGAGCGACGAGGAAGCAGGCCAGAGGTGGAGGCTG
CAGCAGTCGTTGAAACGAGACCGCGAAAACACGAGCGTGCTGGTGAGGGGCCTGCCTGGCCAGGCGAGCGAGACC
AAGGTGCGGCAATACTTCAAGGACTATGGACACATCAACAACCTGACGGCCTTTGTCCACGACAAGGACGGGTCG
TCGACGACGGCGCTGATTGAGTTTGGCACGGCGCAAGAGGCACAGTCTGCGCTGCTGCGCGACAAGAAGTATTTT
GGGCAGTCGCAAATCAGCGTGCAGCCGGGCCACGACCTGACTGTCTACCTGGCCAACTACCCGCCAACGGCCGAC
GACAAGTACATGCGCAGGCTCTTCAAGGACTGCGGCGAGGTGCTGAGCGTGCGGTGGCCGAGCCTCAAGGTGAAC
TCGCACCGCCGCTTCTGCTACGTGACGTTTGGCGAGCGCAGCGCGTCGGCCAAGGCGGTGGCCAAGGACGGCCGG
CTGCTCGACGGCAAGTATCGGCTGCTGGCCAAGTATTCGGATCCGCAGCAGCGCAAGAAGCGCGAGGGCGCCGTG
GCTGAGGGCCGCGAGGTGCACGTGACGGGGCTGGACCGCGGCGTGACGGCGGAGGAGCTGGAGCAGGTGTTTGGC
AAGTATGGCAGCGTGGGACGCGTCAACGTGCCGCGCACGCTGGCGGGCAAGAGCAAGGGCTTTGCCTATGTCGAC
TTTGAGACGGGCGAGCAGGCAGAGCAGGCGGCGCGCGAGCTCAATGGCGTCAAGCTGGCGTCGCAAATCATCAAG
GTGGCCGTGTCGCGCGAGACGCGTGTCAAGCCCTCGGCAACAAGCACTCTTGGCCCCTCGCCCACGGACACGGAG
GCGCCCTCGGCCGAGCAAATTGCAGACCGCACCATTGCGCTGCTCGGCCTGCCCGACACGGTCAATGACGCCCGC
GTTGCTGCCCTGCTGGACCCCATGGGCCCCGTGCTGAAGCTGCTTGTCCAGCCTGCGCACGGCGGCGCCCGCATC
GAGTTTGCAGACGCCGCCGCTGCCGGCCGCGCAGCCCTGCGTCTTGACGGCATCGACTTTGACGGCCATAGGCTG
CGCGTCGGCTCCCTAGACGACTTGCGCCGCGCAAGGGCAGAGCAGCCCCAGAGCCGCATCGTCTACGGCGCCCAG
CCTGTCGCGTCGTCGTCGTCGCTGCTGGCGCCCACTTCGCTGACGGTTCGACGCCCGGGGCCTGCTGCCAAGACG
CCGCGCCCGCCGCCTGCTGCGCTGCACCGCAAAAGCCTACCCCAGGGCCATGCTGATGCGCCAGGCGCAAAGACG
AACCAAGACTTTACAAGACTTTTTCTCGCCACCGCCCAGCAAAAGGCTGAGCCCAATCAAGACGCCGAGGCCAGC
TAG
Transcript >OphauB2|101
ATGGCCATGATGGTAGGCGAGGATAGCTGGATGGACTACTTGGAAGAGGCGGCGCGCGACGCCGATTTGGAGCAG
ACGGTGCATGTCATCGAGCTCTACAAGCGGGCCATTGACGCAGAGCCGGGTAGTCTTGGGCTCTGGCTGGCCTAC
TGCAACTATTTCTGGCAGCTGTGGGAGAGGTGCCAGGCCCCAGAGGCCACTGGCGGCTGGTCCGAAGATGAGCAG
CTCATGGGCCGCGAAATCTTTTCCTTTGGAGCTGCTCTGGACCTCTGGCAGCAGGGATACGAGGCGATTAAGCTG
CGCATCAATGATAGCCACTTGCTCTGGGACCGCTGGCTGAGCCTGGAAATGGAGCAACTGGCCAAGACGAAGACT
CCCGAGGGCATCCGTCGCATCACGCATTTGTACCGCGACCGTCTTCTCATTCCCCATGTTACATGGGACCACACT
TCACAGGCCTTTTCCACCTTTGTCTCGGAACACAATACGTCGGCGTGGGAAGAGACGATGAAGCAGGTGACGGCC
TCGGCGCAAGGCGTCAAGCGTGTCATTGCCGCGCGAGACGGGTTTGAGCTCAAGCTCAAGCAAGCGGCGCGCTCA
CAAGACGGCGAGGCGCAAAAGTCAATCATGAGGGAGTATCTGGAGTGGGAGATGCAGCAGAGCAAGAAGCCCAAG
GACTTGGCTGAAATGGCTGTTGATCTCTGCTGCGGCCTCTTTTCGCGTGCCCTGACGGGCGTCTTTGCGCTCGAC
GAGCATGTCTGGCTCGAGTACATTGTCTACATTGCTTCGGTTCCCTCGGACTGCCAGCCGCCCAAGAAACTGCTG
GATGTGCTGCGGCGCGCCGTGGAGCACTGTCCTTGGTCTGGCCAGCTCTGGAACAGGTACATTTTGTGTGCCGAA
GAGGCCAAGCTTGCCTTTTCGGAAATCGAGTCCATCAAGCACTCGGCAACAAGCGACAACCAGCTGTACAAGAAT
GGCATGGAGAGCATGATTGAAATGTACGTGGCGTGGTGCGGCTTTCTCAAGCGCACGGCTCTCGAGGCCACTGCG
GCCGACGAGGCGGTGGATGTGGCAGACGTTGGTCTGCGAGCAGCGCTGGAGGATGTGGCCGTGGTTGGCAAGCGG
CTCTACGGCAAGGAATTCAAGGGCGACCCCAAATTCCGGCTGGAGCGCATATACATGCAGTATCTGACGGAGAAG
AAGGGGGCGATTGACGAGGCTCGGACAATGTGGAATAAGCTGGCCGACATGAAGATGCATGCCGACAGCTACGAG
TTTTGGTTTGCCTTTTACATGTGGGAGATGGCCATGTTTTCCTCGAACCTGCCGTCGAACCGAAGCCCGACGCCG
TCGTCGACGGGGCTGGGCATGCGCATTCCCACAGACGCCACAGCAGTTTTGCACGCGGCCGCCACGCGAGAAACA
ATAGACTGGCCAGAGCGCATCCTCGAGGTGTACCTGCAGCACTGCAATGACTATGAGCAGCCAGCCACGGTGCGG
CTTGCCACGGACACGGTGCACAGGGTCGGGCAGGCGGTGCAGAAGCGGCGGCAGGGCGAGGAGGAGGAAAAGGCG
GCGGCCTATGCGGCCTACTATGCCAGAGCGCAGCAGGGCGACGAGGAGACGTCGAAGCGCAAACGGGAGGCCCAG
GCAGATGGGGCAGAGAGTGAGAGCGGCAGCAAGCGGCAGCGGAGCGACGAGGAAGCAGGCCAGAGGTGGAGGCTG
CAGCAGTCGTTGAAACGAGACCGCGAAAACACGAGCGTGCTGGTGAGGGGCCTGCCTGGCCAGGCGAGCGAGACC
AAGGTGCGGCAATACTTCAAGGACTATGGACACATCAACAACCTGACGGCCTTTGTCCACGACAAGGACGGGTCG
TCGACGACGGCGCTGATTGAGTTTGGCACGGCGCAAGAGGCACAGTCTGCGCTGCTGCGCGACAAGAAGTATTTT
GGGCAGTCGCAAATCAGCGTGCAGCCGGGCCACGACCTGACTGTCTACCTGGCCAACTACCCGCCAACGGCCGAC
GACAAGTACATGCGCAGGCTCTTCAAGGACTGCGGCGAGGTGCTGAGCGTGCGGTGGCCGAGCCTCAAGGTGAAC
TCGCACCGCCGCTTCTGCTACGTGACGTTTGGCGAGCGCAGCGCGTCGGCCAAGGCGGTGGCCAAGGACGGCCGG
CTGCTCGACGGCAAGTATCGGCTGCTGGCCAAGTATTCGGATCCGCAGCAGCGCAAGAAGCGCGAGGGCGCCGTG
GCTGAGGGCCGCGAGGTGCACGTGACGGGGCTGGACCGCGGCGTGACGGCGGAGGAGCTGGAGCAGGTGTTTGGC
AAGTATGGCAGCGTGGGACGCGTCAACGTGCCGCGCACGCTGGCGGGCAAGAGCAAGGGCTTTGCCTATGTCGAC
TTTGAGACGGGCGAGCAGGCAGAGCAGGCGGCGCGCGAGCTCAATGGCGTCAAGCTGGCGTCGCAAATCATCAAG
GTGGCCGTGTCGCGCGAGACGCGTGTCAAGCCCTCGGCAACAAGCACTCTTGGCCCCTCGCCCACGGACACGGAG
GCGCCCTCGGCCGAGCAAATTGCAGACCGCACCATTGCGCTGCTCGGCCTGCCCGACACGGTCAATGACGCCCGC
GTTGCTGCCCTGCTGGACCCCATGGGCCCCGTGCTGAAGCTGCTTGTCCAGCCTGCGCACGGCGGCGCCCGCATC
GAGTTTGCAGACGCCGCCGCTGCCGGCCGCGCAGCCCTGCGTCTTGACGGCATCGACTTTGACGGCCATAGGCTG
CGCGTCGGCTCCCTAGACGACTTGCGCCGCGCAAGGGCAGAGCAGCCCCAGAGCCGCATCGTCTACGGCGCCCAG
CCTGTCGCGTCGTCGTCGTCGCTGCTGGCGCCCACTTCGCTGACGGTTCGACGCCCGGGGCCTGCTGCCAAGACG
CCGCGCCCGCCGCCTGCTGCGCTGCACCGCAAAAGCCTACCCCAGGGCCATGCTGATGCGCCAGGCGCAAAGACG
AACCAAGACTTTACAAGACTTTTTCTCGCCACCGCCCAGCAAAAGGCTGAGCCCAATCAAGACGCCGAGGCCAGC
TAG
Gene >OphauB2|101
ATGGCCATGATGGTAGGCGAGGATAGCTGGATGGACTACTTGGAAGAGGCGGCGCGCGACGCCGATTTGGAGCAG
ACGGTGCATGTCATCGAGCTCTACAAGCGGGCCATTGACGCAGAGCCGGGTAGTCTTGGGCTCTGGCTGGCCTAC
TGCAACTATTTCTGGCAGCTGTGGGAGAGGTGCCAGGCCCCAGAGGCCACTGGCGGCTGGTCCGAAGATGAGCAG
CTCATGGGCCGCGAAATCTTTTCCTTTGGAGCTGCTCTGGACCTCTGGCAGCAGGGATACGAGGCGATTAAGCTG
CGCATCAATGATAGCCACTTGCTCTGGGACCGCTGGCTGAGCCTGGAAATGGAGCAACTGGCCAAGACGAAGACT
CCCGAGGGCATCCGTCGCATCACGCATTTGTACCGCGACCGTCTTCTCATTCCCCATGTTACATGGGACCACACT
TCACAGGCCTTTTCCACCTTTGTCTCGGAACACAATACGTCGGCGTGGGAAGAGACGATGAAGCAGGTGACGGCC
TCGGCGCAAGGCGTCAAGCGTGTCATTGCCGCGCGAGACGGGTTTGAGCTCAAGCTCAAGCAAGCGGCGCGCTCA
CAAGACGGCGAGGCGCAAAAGTCAATCATGAGGGAGTATCTGGAGTGGGAGATGCAGCAGAGCAAGAAGCCCAAG
GACTTGGCTGAAATGGCTGTTGATCTCTGCTGCGGCCTCTTTTCGCGTGCCCTGACGGGCGTCTTTGCGCTCGAC
GAGCATGTCTGGCTCGAGTACATTGTCTACATTGCTTCGGTTCCCTCGGACTGCCAGCCGCCCAAGAAACTGCTG
GATGTGCTGCGGCGCGCCGTGGAGCACTGTCCTTGGTCTGGCCAGCTCTGGAACAGGTACATTTTGTGTGCCGAA
GAGGCCAAGCTTGCCTTTTCGGAAATCGAGTCCATCAAGCACTCGGCAACAAGCGACAACCAGCTGTACAAGAAT
GGCATGGAGAGCATGATTGAAATGTACGTGGCGTGGTGCGGCTTTCTCAAGCGCACGGCTCTCGAGGCCACTGCG
GCCGACGAGGCGGTGGATGTGGCAGACGTTGGTCTGCGAGCAGCGCTGGAGGATGTGGCCGTGGTTGGCAAGCGG
CTCTACGGCAAGGAATTCAAGGGCGACCCCAAATTCCGGCTGGAGCGCATATACATGCAGTATCTGACGGAGAAG
AAGGGGGCGATTGACGAGGCTCGGACAATGTGGAATAAGCTGGCCGACATGAAGATGCATGCCGACAGCTACGAG
TTTTGGTTTGCCTTTTACATGTGGGAGATGGCCATGTTTTCCTCGAACCTGCCGTCGAACCGAAGCCCGACGCCG
TCGTCGACGGGGCTGGGCATGCGCATTCCCACAGACGCCACAGCAGTTTTGCACGCGGCCGCCACGCGAGAAACA
ATAGACTGGCCAGAGCGCATCCTCGAGGTGTACCTGCAGCACTGCAATGACTATGAGCAGCCAGCCACGGTGCGG
CTTGCCACGGACACGGTGCACAGGGTCGGGCAGGCGGTGCAGAAGCGGCGGCAGGGCGAGGAGGAGGAAAAGGCG
GCGGCCTATGCGGCCTACTATGCCAGAGCGCAGCAGGGCGACGAGGAGACGTCGAAGCGCAAACGGGAGGCCCAG
GCAGATGGGGCAGAGAGTGAGAGCGGCAGCAAGCGGCAGCGGAGCGACGAGGAAGCAGGCCAGAGGTGGAGGCTG
CAGCAGTCGTTGAAACGAGACCGCGAAAACACGAGCGTGCTGGTGAGGGGCCTGCCTGGCCAGGCGAGCGAGACC
AAGGTGCGGCAATACTTCAAGGACTATGGACACATCAACAACCTGACGGCCTTTGTCCACGACAAGGACGGGTCG
TCGACGACGGCGCTGATTGAGTTTGGCACGGCGCAAGAGGCACAGTCTGCGCTGCTGCGCGACAAGAAGTATTTT
GGGCAGTCGCAAATCAGCGTGCAGCCGGGCCACGACCTGACTGTCTACCTGGCCAACTACCCGCCAACGGCCGAC
GACAAGTACATGCGCAGGCTCTTCAAGGACTGCGGCGAGGTGCTGAGCGTGCGGTGGCCGAGCCTCAAGGTGAAC
TCGCACCGCCGCTTCTGCTACGTGACGTTTGGCGAGCGCAGCGCGTCGGCCAAGGCGGTGGCCAAGGACGGCCGG
CTGCTCGACGGCAAGTATCGGCTGCTGGCCAAGTATTCGGATCCGCAGCAGCGCAAGAAGCGCGAGGGCGCCGTG
GCTGAGGGCCGCGAGGTGCACGTGACGGGGCTGGACCGCGGCGTGACGGCGGAGGAGCTGGAGCAGGTGTTTGGC
AAGTATGGCAGCGTGGGACGCGTCAACGTGCCGCGCACGCTGGCGGGCAAGAGCAAGGGCTTTGCCTATGTCGAC
TTTGAGACGGGCGAGCAGGCAGAGCAGGCGGCGCGCGAGCTCAATGGCGTCAAGCTGGCGTCGCAAATCATCAAG
GTGGCCGTGTCGCGCGAGACGCGTGTCAAGCCCTCGGCAACAAGCACTCTTGGCCCCTCGCCCACGGACACGGAG
GCGCCCTCGGCCGAGCAAATTGCAGACCGCACCATTGCGCTGCTCGGCCTGCCCGACACGGTCAATGACGCCCGC
GTTGCTGCCCTGCTGGACCCCATGGGCCCCGTGCTGAAGCTGCTTGTCCAGCCTGCGCACGGCGGCGCCCGCATC
GAGTTTGCAGACGCCGCCGCTGCCGGCCGCGCAGCCCTGCGTCTTGACGGCATCGACTTTGACGGCCATAGGCTG
CGCGTCGGCTCCCTAGACGACTTGCGCCGCGCAAGGGCAGAGCAGCCCCAGAGCCGCATCGTCTACGGCGCCCAG
CCTGTCGCGTCGTCGTCGTCGCTGCTGGCGCCCACTTCGCTGACGGTTCGACGCCCGGGGCCTGCTGCCAAGACG
CCGCGCCCGCCGCCTGCTGCGCTGCACCGCAAAAGCCTACCCCAGGGCCATGCTGATGCGCCAGGCGCAAAGACG
AACCAAGACTTTACAAGACTTTTTCTCGCCACCGCCCAGCAAAAGGCTGAGCCCAATCAAGACGCCGAGGCCAGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail