Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1002
Gene name
LocationContig_122:12527..13889
Strand-
Gene length (bp)1362
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 6.6E-35 202 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 73 453 7.0E-55
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 86 451 3.0E-51
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 190 451 1.0E-50
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 195 451 5.0E-50
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 156 451 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 73 453 7.0E-55
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 86 451 3.0E-51
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 190 451 1.0E-50
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 195 451 5.0E-50
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 156 451 3.0E-49
sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 162 451 4.0E-49
sp|Q1JP61|KDM8_BOVIN Lysine-specific demethylase 8 OS=Bos taurus GN=KDM8 PE=2 SV=1 180 451 1.0E-47
sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 190 451 3.0E-47
sp|Q55DF5|JMJCD_DICDI JmjC domain-containing protein D OS=Dictyostelium discoideum GN=jcdD PE=3 SV=1 182 447 4.0E-45
sp|Q54FG7|JMJCF_DICDI JmjC domain-containing protein F OS=Dictyostelium discoideum GN=jcdF PE=3 SV=1 208 451 9.0E-29
sp|Q8BLR9|HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus GN=Hif1an PE=1 SV=2 330 453 8.0E-11
sp|Q9NWT6|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens GN=HIF1AN PE=1 SV=2 330 453 3.0E-10
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 181 451 1.0E-06
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 209 451 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1002
MDSARWQLLAHYLEAARAIAAAQAGGSSGSARLEAARQLLGRQAVLVEQLQEQPTGKEHVALLQRRLDDVVGMAR
RSLYAYRFDGVPQGWRALYTDGVVLATHVAVVQWQRGEAADQDMLDGVVHRLDRALITTGGASSTRCIGAGWVER
ALRLLQSALGPPQPADSPECFSEAEPFGCPPLAGRSLCRRLSGWSMERFQLHMRHDASPLVFTDLMAHWPALTDR
PWRRRAYLLAQTLDGRRLVPVEVGRSYVDKGWGQELIPFGRFLHDYIDAPLQTRATAYLAQHNLFHQIPALRNDI
AIPDYCWAAACACHDAPQPLLNAWFGPPRTITPLHTDAHDNLLCQVVGRKYVRLYPPSATHAMSPRGREHGVDMA
NTSSLDLGLVEGWDEEPLAQAHCSQHAMLLHQARQRLRSVHHVECILGPGDALLIPKGWWHYVRSLSISFTVSFW
WKG*
Coding >OphauB2|1002
ATGGACAGCGCCAGGTGGCAGCTCCTGGCACACTACCTGGAAGCAGCAAGGGCCATTGCCGCGGCGCAGGCAGGC
GGCAGCTCGGGTTCGGCTCGGCTCGAGGCGGCCAGACAGCTGCTCGGGCGGCAAGCCGTGCTGGTGGAGCAGCTC
CAGGAGCAGCCGACGGGCAAGGAGCATGTGGCTCTGCTGCAGCGGCGGCTCGACGACGTGGTGGGCATGGCAAGG
CGCAGTCTGTACGCCTACCGCTTCGACGGGGTGCCACAGGGCTGGCGGGCGCTGTACACAGACGGCGTGGTGCTG
GCGACGCACGTGGCAGTGGTGCAGTGGCAGCGCGGCGAGGCAGCGGACCAGGACATGCTCGACGGCGTGGTGCAC
AGGCTGGACCGCGCCCTCATCACCACGGGCGGCGCCAGCTCCACGCGCTGCATCGGCGCCGGCTGGGTGGAGCGC
GCGCTGCGTCTGCTGCAGAGCGCCCTTGGCCCGCCGCAGCCGGCCGACAGCCCCGAGTGCTTCTCCGAGGCCGAG
CCCTTTGGCTGTCCGCCCCTCGCCGGCCGCTCGCTGTGCCGCCGGCTGTCGGGCTGGTCCATGGAGCGCTTCCAG
CTGCACATGCGCCACGACGCCTCGCCCCTCGTCTTCACCGACCTCATGGCCCACTGGCCCGCGCTGACGGACCGG
CCCTGGCGGCGCCGCGCCTATCTGCTGGCCCAGACGCTCGACGGCCGCCGCCTCGTGCCCGTCGAGGTGGGCCGC
AGCTACGTCGACAAGGGCTGGGGCCAGGAGCTGATTCCCTTTGGCCGCTTCCTGCACGACTACATTGACGCGCCG
CTGCAGACACGAGCCACGGCATACCTGGCCCAGCACAACCTCTTCCACCAGATCCCCGCCCTGCGCAACGACATT
GCCATTCCCGACTACTGCTGGGCTGCTGCCTGCGCCTGCCACGACGCCCCCCAGCCGCTCCTCAATGCCTGGTTT
GGGCCCCCGCGCACAATCACGCCCCTCCACACCGACGCCCACGACAATCTGCTCTGCCAGGTCGTGGGCCGCAAG
TACGTCCGCCTCTACCCGCCCTCTGCCACCCACGCCATGTCTCCCCGCGGCCGCGAGCACGGCGTCGACATGGCA
AACACTAGCAGCCTTGATCTCGGCCTCGTCGAGGGCTGGGATGAGGAGCCCCTTGCCCAAGCCCACTGCTCCCAG
CACGCCATGCTGCTGCACCAGGCCAGGCAGCGTCTGAGGAGTGTCCACCATGTCGAATGCATCCTCGGCCCCGGC
GATGCCCTCCTCATTCCCAAAGGCTGGTGGCATTACGTCCGCAGCTTGAGCATTAGCTTCACTGTCAGCTTCTGG
TGGAAAGGCTAA
Transcript >OphauB2|1002
ATGGACAGCGCCAGGTGGCAGCTCCTGGCACACTACCTGGAAGCAGCAAGGGCCATTGCCGCGGCGCAGGCAGGC
GGCAGCTCGGGTTCGGCTCGGCTCGAGGCGGCCAGACAGCTGCTCGGGCGGCAAGCCGTGCTGGTGGAGCAGCTC
CAGGAGCAGCCGACGGGCAAGGAGCATGTGGCTCTGCTGCAGCGGCGGCTCGACGACGTGGTGGGCATGGCAAGG
CGCAGTCTGTACGCCTACCGCTTCGACGGGGTGCCACAGGGCTGGCGGGCGCTGTACACAGACGGCGTGGTGCTG
GCGACGCACGTGGCAGTGGTGCAGTGGCAGCGCGGCGAGGCAGCGGACCAGGACATGCTCGACGGCGTGGTGCAC
AGGCTGGACCGCGCCCTCATCACCACGGGCGGCGCCAGCTCCACGCGCTGCATCGGCGCCGGCTGGGTGGAGCGC
GCGCTGCGTCTGCTGCAGAGCGCCCTTGGCCCGCCGCAGCCGGCCGACAGCCCCGAGTGCTTCTCCGAGGCCGAG
CCCTTTGGCTGTCCGCCCCTCGCCGGCCGCTCGCTGTGCCGCCGGCTGTCGGGCTGGTCCATGGAGCGCTTCCAG
CTGCACATGCGCCACGACGCCTCGCCCCTCGTCTTCACCGACCTCATGGCCCACTGGCCCGCGCTGACGGACCGG
CCCTGGCGGCGCCGCGCCTATCTGCTGGCCCAGACGCTCGACGGCCGCCGCCTCGTGCCCGTCGAGGTGGGCCGC
AGCTACGTCGACAAGGGCTGGGGCCAGGAGCTGATTCCCTTTGGCCGCTTCCTGCACGACTACATTGACGCGCCG
CTGCAGACACGAGCCACGGCATACCTGGCCCAGCACAACCTCTTCCACCAGATCCCCGCCCTGCGCAACGACATT
GCCATTCCCGACTACTGCTGGGCTGCTGCCTGCGCCTGCCACGACGCCCCCCAGCCGCTCCTCAATGCCTGGTTT
GGGCCCCCGCGCACAATCACGCCCCTCCACACCGACGCCCACGACAATCTGCTCTGCCAGGTCGTGGGCCGCAAG
TACGTCCGCCTCTACCCGCCCTCTGCCACCCACGCCATGTCTCCCCGCGGCCGCGAGCACGGCGTCGACATGGCA
AACACTAGCAGCCTTGATCTCGGCCTCGTCGAGGGCTGGGATGAGGAGCCCCTTGCCCAAGCCCACTGCTCCCAG
CACGCCATGCTGCTGCACCAGGCCAGGCAGCGTCTGAGGAGTGTCCACCATGTCGAATGCATCCTCGGCCCCGGC
GATGCCCTCCTCATTCCCAAAGGCTGGTGGCATTACGTCCGCAGCTTGAGCATTAGCTTCACTGTCAGCTTCTGG
TGGAAAGGCTAA
Gene >OphauB2|1002
ATGGACAGCGCCAGGTGGCAGCTCCTGGCACACTACCTGGAAGCAGCAAGGGCCATTGCCGCGGCGCAGGCAGGC
GGCAGCTCGGGTTCGGCTCGGCTCGAGGCGGCCAGACAGCTGCTCGGGCGGCAAGCCGTGCTGGTGGAGCAGCTC
CAGGAGCAGCCGACGGGCAAGGAGCATGTGGCTCTGCTGCAGCGGCGGCTCGACGACGTGGTGGGCATGGCAAGG
CGCAGTCTGTACGCCTACCGCTTCGACGGGGTGCCACAGGGCTGGCGGGCGCTGTACACAGACGGCGTGGTGCTG
GCGACGCACGTGGCAGTGGTGCAGTGGCAGCGCGGCGAGGCAGCGGACCAGGACATGCTCGACGGCGTGGTGCAC
AGGCTGGACCGCGCCCTCATCACCACGGGCGGCGCCAGCTCCACGCGCTGCATCGGCGCCGGCTGGGTGGAGCGC
GCGCTGCGTCTGCTGCAGAGCGCCCTTGGCCCGCCGCAGCCGGCCGACAGCCCCGAGTGCTTCTCCGAGGCCGAG
CCCTTTGGCTGTCCGCCCCTCGCCGGCCGCTCGCTGTGCCGCCGGCTGTCGGGCTGGTCCATGGAGCGCTTCCAG
CTGCACATGCGCCACGACGCCTCGCCCCTCGTCTTCACCGACCTCATGGCCCACTGGCCCGCGCTGACGGACCGG
CCCTGGCGGCGCCGCGCCTATCTGCTGGCCCAGACGCTCGACGGCCGCCGCCTCGTGCCCGTCGAGGTGGGCCGC
AGCTACGTCGACAAGGGCTGGGGCCAGGAGCTGATTCCCTTTGGCCGCTTCCTGCACGACTACATTGACGCGCCG
CTGCAGACACGAGCCACGGCATACCTGGCCCAGCACAACCTCTTCCACCAGATCCCCGCCCTGCGCAACGACATT
GCCATTCCCGACTACTGCTGGGCTGCTGCCTGCGCCTGCCACGACGCCCCCCAGCCGCTCCTCAATGCCTGGTTT
GGGCCCCCGCGCACAATCACGCCCCTCCACACCGACGCCCACGACAATCTGCTCTGCCAGGTCGTGGGCCGCAAG
TACGTCCGCCTCTACCCGCCCTCTGCCACCCACGCCATGTCTCCCCGCGGCCGCGAGCACGGCGTCGACATGGCA
AACACTAGCAGCCTTGATCTCGGCCTCGTCGAGGGCTGGGATGAGGAGCCCCTTGCCCAAGCCCACTGCTCCCAG
CACGCCATGCTGCTGCACCAGGCCAGGCAGCGTCTGAGGAGTGTCCACCATGTCGAATGCATCCTCGGCCCCGGC
GATGCCCTCCTCATTCCCAAAGGCTGGTGGCATTACGTCCGCAGCTTGAGCATTAGCTTCACTGTCAGCTTCTGG
TGGAAAGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail