Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1
Gene name
LocationContig_1:2017..3204
Strand+
Gene length (bp)1187
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.8E-14 35 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 1 113 6.0E-41
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 1 118 3.0E-40
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 1 113 7.0E-40
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 1 109 1.0E-38
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 1 118 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 1 113 6.0E-41
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 1 118 3.0E-40
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 1 113 7.0E-40
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 1 109 1.0E-38
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 1 118 1.0E-38
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 1 123 7.0E-37
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 1 114 5.0E-36
sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 10 106 7.0E-11
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 35 108 9.0E-11
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 10 106 2.0E-10
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 35 110 7.0E-10
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 35 109 8.0E-10
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 35 110 1.0E-09
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 35 109 1.0E-09
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 35 109 1.0E-09
sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 10 106 1.0E-09
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 35 109 1.0E-09
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 35 109 1.0E-09
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 35 109 4.0E-09
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 35 109 4.0E-09
sp|Q00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNP1 PE=1 SV=1 1 110 5.0E-09
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 10 106 5.0E-09
sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 10 106 6.0E-09
sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=3 SV=2 10 106 2.0E-08
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 35 110 2.0E-08
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 31 114 2.0E-08
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 35 110 2.0E-08
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 10 106 5.0E-08
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 35 110 6.0E-08
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 6 160 6.0E-08
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 35 110 6.0E-08
sp|Q9P6P7|YKCG_SCHPO Uncharacterized RNA-binding protein C644.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.16 PE=3 SV=1 32 108 1.0E-07
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 35 109 1.0E-07
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 35 110 1.0E-07
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 35 106 2.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 35 113 2.0E-07
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 35 109 3.0E-07
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 35 109 4.0E-07
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 35 109 4.0E-07
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 35 109 5.0E-07
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 35 122 7.0E-07
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 35 116 9.0E-07
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 33 109 9.0E-07
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 35 110 1.0E-06
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 35 109 1.0E-06
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 35 110 1.0E-06
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 35 120 1.0E-06
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 23 110 1.0E-06
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 52 113 2.0E-06
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 35 115 2.0E-06
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 35 115 2.0E-06
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 18 117 3.0E-06
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 35 109 4.0E-06
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 35 105 4.0E-06
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 35 110 5.0E-06
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 35 109 5.0E-06
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 24 111 7.0E-06
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 11 119 7.0E-06
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 35 110 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1
MNKIRAIQALNQKEIEQGISPNASWHTDYRDTAFVYFGGLPYDLSEGDVITIFSQFGEPVFLKLVRDAETGKSKG
FGWLKYEDQRSTDLAVDNLGGAHIGGRLISVDHARYKARDDEDPAEYAVSWQDMRRRQGLAVSDDEASDADGHVP
RPLLPEERQLADLMQNHDDDDPMKMYLIEEKKKEVEEARERAENKDRKRKHRHHGSSKHRRDEDETRSRRHQDDD
SADHSRHSRHHEHRHKRHGRDTAISRHTERSPSRTKQRPSHDSDADQRSKRPRRDHSRDDWSQRRRDDATEPSYR
SRRHDSEDLERDSRRSRTPVKSERQQDDADNHYHDSCRRRHRLQDSRRHDFSDASMHKRGDPRTDRPTRHRSRSN
SR*
Coding >OphauB2|1
ATGAACAAGATACGCGCCATCCAGGCTCTCAATCAAAAAGAGATTGAGCAGGGCATCTCTCCCAATGCCTCTTGG
CACACCGACTACCGCGACACCGCCTTTGTCTACTTTGGCGGCCTTCCATACGACCTGTCTGAAGGCGACGTCATC
ACCATCTTCTCCCAGTTTGGCGAACCCGTATTCCTCAAGCTTGTCCGCGACGCAGAAACGGGCAAGTCCAAAGGC
TTTGGCTGGCTCAAGTATGAAGACCAGCGCAGCACCGACCTTGCCGTTGACAACCTCGGCGGCGCCCATATTGGC
GGCCGTCTCATTAGCGTCGACCATGCGCGCTACAAGGCCCGCGACGACGAGGACCCTGCCGAGTATGCCGTGAGC
TGGCAAGACATGCGGCGGCGACAGGGGCTGGCCGTGTCAGACGACGAAGCCAGCGATGCTGATGGCCACGTGCCA
CGGCCACTGCTGCCCGAGGAGCGACAACTGGCCGACTTGATGCAAAACCACGACGACGACGATCCCATGAAGATG
TACCTCATTGAAGAAAAGAAGAAGGAGGTGGAGGAGGCGCGTGAAAGGGCTGAAAATAAGGACCGGAAGCGAAAA
CACCGACATCATGGCTCCTCCAAGCACAGACGAGATGAAGATGAGACGCGCTCCAGACGACACCAGGACGATGAT
TCTGCCGACCACTCCCGACACAGTCGTCACCACGAGCATCGTCACAAAAGACATGGTCGTGACACAGCTATAAGT
CGCCATACAGAGCGCTCTCCCAGCAGGACAAAGCAAAGACCTTCCCACGACTCTGATGCTGATCAACGATCCAAA
AGGCCTCGTCGAGACCACTCCCGCGACGACTGGTCCCAAAGACGCCGCGACGATGCAACAGAGCCATCATATCGA
TCAAGACGCCATGACAGTGAGGACCTTGAAAGGGATTCGCGCCGTAGTCGGACACCCGTGAAGAGTGAGCGGCAA
CAAGACGATGCCGACAATCACTATCACGACTCTTGTCGCCGACGCCATCGGCTTCAAGATTCCCGGAGACACGAC
TTCAGTGATGCAAGTATGCACAAACGAGGTGACCCTAGAACCGACAGGCCAACAAGGCACAGGAGTAGGAGCAAT
TCGCGGTAG
Transcript >OphauB2|1
ATGAACAAGATACGCGCCATCCAGGCTCTCAATCAAAAAGAGATTGAGCAGGGCATCTCTCCCAATGCCTCTTGG
CACACCGACTACCGCGACACCGCCTTTGTCTACTTTGGCGGCCTTCCATACGACCTGTCTGAAGGCGACGTCATC
ACCATCTTCTCCCAGTTTGGCGAACCCGTATTCCTCAAGCTTGTCCGCGACGCAGAAACGGGCAAGTCCAAAGGC
TTTGGCTGGCTCAAGTATGAAGACCAGCGCAGCACCGACCTTGCCGTTGACAACCTCGGCGGCGCCCATATTGGC
GGCCGTCTCATTAGCGTCGACCATGCGCGCTACAAGGCCCGCGACGACGAGGACCCTGCCGAGTATGCCGTGAGC
TGGCAAGACATGCGGCGGCGACAGGGGCTGGCCGTGTCAGACGACGAAGCCAGCGATGCTGATGGCCACGTGCCA
CGGCCACTGCTGCCCGAGGAGCGACAACTGGCCGACTTGATGCAAAACCACGACGACGACGATCCCATGAAGATG
TACCTCATTGAAGAAAAGAAGAAGGAGGTGGAGGAGGCGCGTGAAAGGGCTGAAAATAAGGACCGGAAGCGAAAA
CACCGACATCATGGCTCCTCCAAGCACAGACGAGATGAAGATGAGACGCGCTCCAGACGACACCAGGACGATGAT
TCTGCCGACCACTCCCGACACAGTCGTCACCACGAGCATCGTCACAAAAGACATGGTCGTGACACAGCTATAAGT
CGCCATACAGAGCGCTCTCCCAGCAGGACAAAGCAAAGACCTTCCCACGACTCTGATGCTGATCAACGATCCAAA
AGGCCTCGTCGAGACCACTCCCGCGACGACTGGTCCCAAAGACGCCGCGACGATGCAACAGAGCCATCATATCGA
TCAAGACGCCATGACAGTGAGGACCTTGAAAGGGATTCGCGCCGTAGTCGGACACCCGTGAAGAGTGAGCGGCAA
CAAGACGATGCCGACAATCACTATCACGACTCTTGTCGCCGACGCCATCGGCTTCAAGATTCCCGGAGACACGAC
TTCAGTGATGCAAGTATGCACAAACGAGGTGACCCTAGAACCGACAGGCCAACAAGGCACAGGAGTAGGAGCAAT
TCGCGGTAG
Gene >OphauB2|1
ATGAACAAGATACGCGCCATCCAGGCTCTCAATCAAAAAGAGATTGAGCAGGGCATGTACGCACGATAGCCTCTT
TCCATCCCTCACATCTACTAACGCCTACTTGCAGCTCTCCCAATGCCTCTTGGCACACCGACTACCGCGACACCG
CCTTTGTCTACTTTGGCGGCCTTCCATACGACCTGTCTGAAGGCGACGTCATCACCATCTTCTCCCAGTTTGGCG
AACCCGTATTCCTCAAGCTTGTCCGCGACGCAGAAACGGGCAAGTCCAAAGGCTTTGGCTGGCTCAAGTATGAAG
ACCAGCGCAGCACCGACCTTGCCGTTGACAACCTCGGCGGCGCCCATATTGGCGGCCGTCTCATTAGCGTCGACC
ATGCGCGCTACAAGGCCCGCGACGACGAGGACCCTGCCGAGTATGCCGTGAGCTGGCAAGACATGCGGCGGCGAC
AGGGGCTGGCCGTGTCAGACGACGAAGCCAGCGATGCTGATGGCCACGTGCCACGGCCACTGCTGCCCGAGGAGC
GACAACTGGCCGACTTGATGCAAAACCACGACGACGACGATCCCATGAAGATGTACCTCATTGAAGAAAAGAAGA
AGGAGGTGGAGGAGGCGCGTGAAAGGGCTGAAAATAAGGACCGGAAGCGAAAACACCGACATCATGGCTCCTCCA
AGCACAGACGAGATGAAGATGAGACGCGCTCCAGACGACACCAGGACGATGATTCTGCCGACCACTCCCGACACA
GTCGTCACCACGAGCATCGTCACAAAAGACATGGTCGTGACACAGCTATAAGTCGCCATACAGAGCGCTCTCCCA
GCAGGACAAAGCAAAGACCTTCCCACGACTCTGATGCTGATCAACGATCCAAAAGGCCTCGTCGAGACCACTCCC
GCGACGACTGGTCCCAAAGACGCCGCGACGATGCAACAGAGCCATCATATCGATCAAGACGCCATGACAGTGAGG
ACCTTGAAAGGGATTCGCGCCGTAGTCGGACACCCGTGAAGAGTGAGCGGCAACAAGACGATGCCGACAATCACT
ATCACGACTCTTGTCGCCGACGCCATCGGCTTCAAGATTCCCGGAGACACGACTTCAGTGATGCAAGTATGCACA
AACGAGGTGACCCTAGAACCGACAGGCCAACAAGGCACAGGAGTAGGAGCAATTCGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail