Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9996
Gene name
LocationContig_770:3313..6112
Strand-
Gene length (bp)2799
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 8.8E-09 216 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 398 710 8.0E-19
sp|C7GP35|RGT1_YEAS2 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RGT1 PE=3 SV=1 209 284 4.0E-15
sp|P32862|RGT1_YEAST Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT1 PE=1 SV=1 209 284 4.0E-15
sp|B3LR49|RGT1_YEAS1 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RGT1 PE=3 SV=1 209 284 4.0E-15
sp|A6ZZS7|RGT1_YEAS7 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RGT1 PE=3 SV=1 209 284 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 398 710 8.0E-19
sp|C7GP35|RGT1_YEAS2 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RGT1 PE=3 SV=1 209 284 4.0E-15
sp|P32862|RGT1_YEAST Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT1 PE=1 SV=1 209 284 4.0E-15
sp|B3LR49|RGT1_YEAS1 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RGT1 PE=3 SV=1 209 284 4.0E-15
sp|A6ZZS7|RGT1_YEAS7 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RGT1 PE=3 SV=1 209 284 4.0E-15
sp|Q750N3|RGT1_ASHGO Glucose transport transcription regulator RGT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RGT1 PE=3 SV=1 209 266 2.0E-14
sp|Q6FLP2|RGT1_CANGA Glucose transport transcription regulator RGT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RGT1 PE=3 SV=1 209 263 9.0E-14
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 210 643 4.0E-13
sp|Q6CIL8|RGT1_KLULA Glucose transport transcription regulator RGT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RGT1 PE=3 SV=1 209 266 7.0E-13
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 211 643 8.0E-13
sp|C5E4G1|RGT1_ZYGRC Glucose transport transcription regulator RGT1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RGT1 PE=3 SV=1 209 286 3.0E-12
sp|C5DGQ7|RGT1_LACTC Glucose transport transcription regulator RGT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RGT1 PE=3 SV=1 209 266 1.0E-11
sp|A7TE38|RGT1_VANPO Glucose transport transcription regulator RGT1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RGT1 PE=3 SV=1 213 264 1.0E-11
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 206 276 5.0E-10
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 209 264 4.0E-09
sp|D3UEC9|EDS1_YEAS8 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EDS1 PE=3 SV=1 209 262 2.0E-08
sp|C7GXX9|EDS1_YEAS2 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain JAY291) GN=EDS1 PE=3 SV=1 209 262 2.0E-08
sp|A6ZKX7|EDS1_YEAS7 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EDS1 PE=3 SV=1 209 262 2.0E-08
sp|B5VDZ9|EDS1_YEAS6 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=EDS1 PE=3 SV=1 209 262 2.0E-08
sp|B3LNB2|EDS1_YEAS1 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=EDS1 PE=3 SV=1 209 262 2.0E-08
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 210 280 6.0E-08
sp|P38073|EDS1_YEAST Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EDS1 PE=1 SV=1 209 262 8.0E-08
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 199 263 2.0E-07
sp|O94278|THI5_SCHPO Thiamine repressible genes regulatory protein thi5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi5 PE=3 SV=1 206 280 1.0E-06
sp|P11638|QA1F_NEUCR Quinic acid utilization activator OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-1f PE=3 SV=2 210 416 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003700 DNA-binding transcription factor activity No
GO:0046914 transition metal ion binding No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9996
LSDLCPRAESTRRLELSRGRRVNARGINPPRARAIKHVCNMSPGREGDQDEAASLTYPSPGAEALEAGPFYHANP
RDGVPEHHPDQPEQQQHAPEEVHAQDQEPGQMQDSATPQQHVSRPANLEELQLAAQLGDGLAGTPIMPATDPNMN
VDDHSMRNIMPHPEPEHHQTPSYVQEAPTTDHLAQHALSVSVGQSVPPPYQISDGIPPRKRSKVSRACDECRRKK
IKCDAPSDTGDTPCSSCARSSIRCLFSRVPQKRGPSKGYIKELADRIHSIENKLESEGNLTQDEIDKLFAPDRPR
SHGHGAPGEEMNRKRPFSSISTADLGTPPTTRQAPWGSEPRPTQPASASSETFPHNLYTNNALAPQPSALKPDVT
PSKPPVASMDASMADVDELPSIDEGILKDYLATIQPLFPILPSSAARVQLLLSQCPPSLREAFFIALATVGQGSP
GDVKHADDLVREWEGSDAPRTRASDIVHAQTLFLFIVDADWRALSTLPFLLARTVALANSMKLWKLAPADTTDPD
SEDMLALKLWWSIIMMDRWHAAGTGKPALIPDSSVVARAGLQTILGEVCFHLTRLSKLLNRIAFVISVMQPGATT
AEQAMATILGDYVENYREDLPAHVDAATYPLVHLAYWHCRLLVTLLTPGATAAEKMWPTRELVSLLSASAQLRSP
LVHHFVSLAALSLSKLARADGTREEAARLIGEIGETAPGGHWDGVQERLAEQLRPVSSVEATASQGLQHLADLAT
AHEGIAPGEGEAVFGPSLAAGYLDVP*
Coding >Hirsu2|9996
CTGTCGGACCTTTGTCCTCGTGCTGAGAGCACGCGCCGCCTCGAGCTGTCGCGCGGCCGCCGCGTCAACGCGCGT
GGAATCAACCCTCCCCGGGCCCGAGCAATCAAGCACGTTTGCAACATGAGCCCAGGCAGGGAGGGCGACCAGGAT
GAGGCTGCCAGCCTCACATATCCGTCTCCCGGTGCCGAGGCGTTGGAGGCCGGGCCCTTCTACCACGCGAATCCG
CGCGATGGGGTGCCAGAACATCACCCTGACCAGCCGGAGCAGCAACAGCACGCCCCCGAGGAAGTGCATGCGCAG
GATCAAGAGCCGGGGCAAATGCAGGATTCGGCCACGCCGCAGCAGCATGTCTCGCGGCCGGCCAACTTGGAAGAG
CTCCAGCTGGCTGCCCAGCTCGGCGATGGCTTGGCCGGCACGCCCATCATGCCCGCCACGGATCCGAACATGAAC
GTGGACGACCATAGTATGCGCAACATCATGCCGCATCCCGAGCCGGAGCACCACCAGACACCCTCTTACGTCCAG
GAGGCTCCCACGACCGATCACCTAGCCCAGCATGCCCTGTCCGTGTCTGTCGGGCAATCCGTGCCCCCCCCGTAC
CAGATTAGCGACGGCATCCCGCCGAGAAAACGGTCCAAGGTGTCCAGAGCCTGCGACGAGTGCCGGCGGAAGAAG
ATAAAATGCGATGCCCCGTCAGACACTGGCGATACCCCATGTTCGAGCTGCGCGCGGTCGTCGATCCGCTGCTTG
TTCAGTCGCGTGCCCCAAAAACGAGGCCCGAGTAAAGGATACATAAAAGAGCTTGCAGACAGAATCCACAGTATC
GAGAACAAGCTCGAGTCTGAGGGCAATCTGACGCAGGATGAAATCGACAAGCTGTTCGCTCCTGATCGGCCCAGG
AGCCATGGCCACGGTGCCCCCGGTGAAGAGATGAATCGAAAACGGCCGTTCTCCAGCATCTCGACTGCGGATTTA
GGCACGCCGCCGACCACTCGTCAAGCACCTTGGGGCTCCGAGCCTCGGCCAACGCAGCCGGCATCGGCGTCTTCC
GAAACCTTCCCCCATAATCTGTACACCAATAATGCCCTCGCGCCTCAGCCCTCGGCCCTGAAGCCCGACGTCACG
CCGTCTAAGCCGCCCGTGGCGTCGATGGATGCTTCGATGGCCGATGTCGACGAATTGCCGAGCATCGATGAGGGT
ATCCTGAAGGACTACCTGGCGACGATCCAACCGTTGTTCCCCATCCTGCCGAGCAGCGCCGCTCGCGTCCAGCTG
CTACTGTCGCAGTGCCCGCCGTCCCTCCGAGAAGCATTCTTCATCGCCCTCGCCACGGTGGGACAAGGCTCGCCC
GGAGACGTCAAGCATGCTGATGATCTCGTGCGGGAATGGGAGGGCAGCGACGCTCCACGCACGCGGGCATCGGAC
ATCGTCCACGCCCAGACTCTCTTCCTCTTCATCGTCGACGCCGACTGGCGCGCGCTGTCCACGTTGCCCTTCCTC
TTGGCGCGGACCGTGGCGCTCGCCAACAGCATGAAGCTCTGGAAACTGGCGCCCGCAGACACGACGGACCCGGAC
TCGGAGGACATGTTGGCACTGAAGCTCTGGTGGTCGATCATCATGATGGACCGTTGGCATGCCGCGGGGACCGGG
AAGCCGGCGCTCATCCCCGACAGCAGCGTCGTGGCGAGGGCGGGCCTGCAGACTATCCTCGGCGAGGTTTGCTTC
CACCTGACACGCCTGTCGAAGCTCCTGAACAGGATCGCCTTTGTCATCTCGGTCATGCAGCCGGGCGCGACGACG
GCCGAGCAAGCCATGGCAACGATCCTGGGCGACTACGTGGAGAACTACCGAGAGGACCTACCGGCGCACGTCGAC
GCGGCGACGTATCCGCTGGTGCACCTGGCCTACTGGCACTGTCGACTGCTGGTGACGCTGCTGACGCCCGGGGCG
ACGGCGGCGGAGAAGATGTGGCCGACGAGGGAGCTGGTCAGCCTGCTGTCGGCAAGCGCGCAGCTGCGGAGCCCG
CTGGTGCACCACTTCGTCTCGCTGGCCGCGCTGTCGCTGTCGAAGCTGGCCAGGGCGGACGGCACGCGCGAGGAG
GCGGCGCGGCTGATTGGCGAGATTGGCGAGACGGCGCCCGGCGGGCACTGGGACGGCGTGCAGGAGCGGCTGGCG
GAGCAGCTGCGGCCGGTGTCGTCGGTGGAGGCGACGGCCAGCCAGGGCCTGCAGCACCTGGCCGACCTGGCGACG
GCACACGAGGGCATCGCGCCGGGCGAGGGCGAGGCCGTCTTCGGGCCGTCGCTGGCGGCCGGCTACCTCGACGTG
CCGTGA
Transcript >Hirsu2|9996
CTGTCGGACCTTTGTCCTCGTGCTGAGAGCACGCGCCGCCTCGAGCTGTCGCGCGGCCGCCGCGTCAACGCGCGT
GGAATCAACCCTCCCCGGGCCCGAGCAATCAAGCACGTTTGCAACATGAGCCCAGGCAGGGAGGGCGACCAGGAT
GAGGCTGCCAGCCTCACATATCCGTCTCCCGGTGCCGAGGCGTTGGAGGCCGGGCCCTTCTACCACGCGAATCCG
CGCGATGGGGTGCCAGAACATCACCCTGACCAGCCGGAGCAGCAACAGCACGCCCCCGAGGAAGTGCATGCGCAG
GATCAAGAGCCGGGGCAAATGCAGGATTCGGCCACGCCGCAGCAGCATGTCTCGCGGCCGGCCAACTTGGAAGAG
CTCCAGCTGGCTGCCCAGCTCGGCGATGGCTTGGCCGGCACGCCCATCATGCCCGCCACGGATCCGAACATGAAC
GTGGACGACCATAGTATGCGCAACATCATGCCGCATCCCGAGCCGGAGCACCACCAGACACCCTCTTACGTCCAG
GAGGCTCCCACGACCGATCACCTAGCCCAGCATGCCCTGTCCGTGTCTGTCGGGCAATCCGTGCCCCCCCCGTAC
CAGATTAGCGACGGCATCCCGCCGAGAAAACGGTCCAAGGTGTCCAGAGCCTGCGACGAGTGCCGGCGGAAGAAG
ATAAAATGCGATGCCCCGTCAGACACTGGCGATACCCCATGTTCGAGCTGCGCGCGGTCGTCGATCCGCTGCTTG
TTCAGTCGCGTGCCCCAAAAACGAGGCCCGAGTAAAGGATACATAAAAGAGCTTGCAGACAGAATCCACAGTATC
GAGAACAAGCTCGAGTCTGAGGGCAATCTGACGCAGGATGAAATCGACAAGCTGTTCGCTCCTGATCGGCCCAGG
AGCCATGGCCACGGTGCCCCCGGTGAAGAGATGAATCGAAAACGGCCGTTCTCCAGCATCTCGACTGCGGATTTA
GGCACGCCGCCGACCACTCGTCAAGCACCTTGGGGCTCCGAGCCTCGGCCAACGCAGCCGGCATCGGCGTCTTCC
GAAACCTTCCCCCATAATCTGTACACCAATAATGCCCTCGCGCCTCAGCCCTCGGCCCTGAAGCCCGACGTCACG
CCGTCTAAGCCGCCCGTGGCGTCGATGGATGCTTCGATGGCCGATGTCGACGAATTGCCGAGCATCGATGAGGGT
ATCCTGAAGGACTACCTGGCGACGATCCAACCGTTGTTCCCCATCCTGCCGAGCAGCGCCGCTCGCGTCCAGCTG
CTACTGTCGCAGTGCCCGCCGTCCCTCCGAGAAGCATTCTTCATCGCCCTCGCCACGGTGGGACAAGGCTCGCCC
GGAGACGTCAAGCATGCTGATGATCTCGTGCGGGAATGGGAGGGCAGCGACGCTCCACGCACGCGGGCATCGGAC
ATCGTCCACGCCCAGACTCTCTTCCTCTTCATCGTCGACGCCGACTGGCGCGCGCTGTCCACGTTGCCCTTCCTC
TTGGCGCGGACCGTGGCGCTCGCCAACAGCATGAAGCTCTGGAAACTGGCGCCCGCAGACACGACGGACCCGGAC
TCGGAGGACATGTTGGCACTGAAGCTCTGGTGGTCGATCATCATGATGGACCGTTGGCATGCCGCGGGGACCGGG
AAGCCGGCGCTCATCCCCGACAGCAGCGTCGTGGCGAGGGCGGGCCTGCAGACTATCCTCGGCGAGGTTTGCTTC
CACCTGACACGCCTGTCGAAGCTCCTGAACAGGATCGCCTTTGTCATCTCGGTCATGCAGCCGGGCGCGACGACG
GCCGAGCAAGCCATGGCAACGATCCTGGGCGACTACGTGGAGAACTACCGAGAGGACCTACCGGCGCACGTCGAC
GCGGCGACGTATCCGCTGGTGCACCTGGCCTACTGGCACTGTCGACTGCTGGTGACGCTGCTGACGCCCGGGGCG
ACGGCGGCGGAGAAGATGTGGCCGACGAGGGAGCTGGTCAGCCTGCTGTCGGCAAGCGCGCAGCTGCGGAGCCCG
CTGGTGCACCACTTCGTCTCGCTGGCCGCGCTGTCGCTGTCGAAGCTGGCCAGGGCGGACGGCACGCGCGAGGAG
GCGGCGCGGCTGATTGGCGAGATTGGCGAGACGGCGCCCGGCGGGCACTGGGACGGCGTGCAGGAGCGGCTGGCG
GAGCAGCTGCGGCCGGTGTCGTCGGTGGAGGCGACGGCCAGCCAGGGCCTGCAGCACCTGGCCGACCTGGCGACG
GCACACGAGGGCATCGCGCCGGGCGAGGGCGAGGCCGTCTTCGGGCCGTCGCTGGCGGCCGGCTACCTCGACGTG
CCGTGA
Gene >Hirsu2|9996
CTGTCGGACCTTTGTCGTAAGTCGACGCCATCCCGATCTGCTGCCAGCATCGCATCAGCCATCGGGCCACGGACA
TTGCCGCCTGGAGCAATGCATTGTGATCTGTGTGGCTGATTGCACGCCGAGTCGCATCCCATTCTGAGCTAACAA
TGGCTTCAGCTCGTGCTGAGAGCACGCGCCGCCTCGAGCTGTCGCGCGGCCGCCGCGTCAACGCGCGTGGAATCG
TCCTTTCGAGACCGCTGGGACCGAGAGAAGGCTGCCCCTTTCTCTCATCGTCGAGCTCCGTTCGCCGAGTCGTCA
ACGAGCCTGCGACGGCGAGGGCAGAGCCCATACCGGTGGAGTCTCCGCCTTGAACCCAGAACCCTCCCCGGGCCC
GAGCAATCAAGCACGTTTGCAACATGAGCCCAGGCAGGGAGGGCGACCAGGATGAGGCTGCCAGCCTCACATATC
CGTCTCCCGGTGCCGAGGCGTTGGAGGCCGGGCCCTTCTACCACGCGAATCCGCGCGATGGGGTGCCAGAACATC
ACCCTGACCAGCCGGAGCAGCAACAGCACGCCCCCGAGGAAGTGCATGCGCAGGATCAAGAGCCGGGGCAAATGC
AGGATTCGGCCACGCCGCAGCAGCATGTCTCGCGGCCGGCCAACTTGGAAGAGCTCCAGCTGGCTGCCCAGCTCG
GCGATGGCTTGGCCGGCACGCCCATCATGCCCGCCACGGATCCGAACATGAACGTGGACGACCATAGTATGCGCA
ACATCATGCCGCATCCCGAGCCGGAGCACCACCAGACACCCTCTTACGTCCAGGAGGCTCCCACGACCGATCACC
TAGCCCAGCATGCCCTGTCCGTGTCTGTCGGGCAATCCGTGCCCCCCCCGTACCAGATTAGCGACGGCATCCCGC
CGAGAAAACGGTCCAAGGTGTCCAGAGCCTGCGACGAGTGCCGGCGGAAGAAGATAAAATGCGATGCCCCGTCAG
ACACTGGCGATACCCCATGTTCGAGCTGCGCGCGGTCGTCGATCCGCTGCTTGTTCAGTCGCGTGCCCCAAAAAC
GAGGCCCGAGTAAAGGGTAAGGCCGGGGTCCGAATCCCAAGATTGGCATGGCCCTGGCCACTGACATCTCTCGCG
CAGATACATAAAAGAGCTTGCAGACAGAATCCACAGTATCGAGAACAAGCTCGAGTCTGAGGGCAATCTGACGCA
GGATGAAATCGACAAGCTGTTCGCTCCTGATCGGCCCAGGAGCCATGGCCACGGTGCCCCCGGTGAAGAGATGAA
TCGAAAACGGCCGTTCTCCAGCATCTCGACTGCGGATTTAGGCACGCCGCCGACCACTCGTCAAGCACCTTGGGG
CTCCGAGCCTCGGCCAACGCAGCCGGCATCGGCGTCTTCCGAAACCTTCCCCCATAATCTGTACACCAATAATGC
CCTCGCGCCTCAGCCCTCGGCCCTGAAGCCCGACGTCACGCCGTCTAAGCCGCCCGTGGCGTCGATGGATGCTTC
GATGGCCGATGTCGACGAATTGCCGAGCATCGATGAGGGTATCCTGAAGGAGTAAGTCGAGCCGGCCAGCACACT
CACGGCGATAGTCAAGGTGGATGCTGACCGGCTTCACAGCTACCTGGCGACGATCCAACCGTTGTTCCCCATCCT
GCCGAGCAGCGCCGCTCGCGTCCAGCTGCTACTGTCGCAGTGCCCGCCGTCCCTCCGAGAAGCATTCTTCATCGC
CCTCGCCACGGTGGGACAAGGCTCGCCCGGAGACGTCAAGCATGCTGATGATCTCGTGCGGGAATGGGAGGGCAG
CGACGCTCCACGCACGCGGGCATCGGACATCGTCCACGCCCAGACTCTCTTCCTCTTCATCGTCGACGCCGACTG
GCGCGCGCTGTCCACGTTGCCCTTCCTCTTGGCGCGGACCGTGGCGCTCGCCAACAGCATGAAGCTCTGGAAACT
GGCGCCCGCAGACACGACGGACCCGGACTCGGAGGACATGTTGGCACTGAAGCTCTGGTGGTCGATCATCATGAT
GGACCGTTGGCATGCCGCGGGGACCGGGAAGCCGGCGCTCATCCCCGACAGCAGCGTCGTGGCGAGGGCGGGCCT
GCAGACTATCCTCGGCGAGGTTTGCTTCCACCTGACACGTAAGTTGGACGCCAGCCTGCAAGCTGTCTCTGTCTC
TCTCGCGTAGCTGACTTTTACTCGGAAGGCCTGTCGAAGCTCCTGAACAGGATCGCCTTTGTCATCTCGGTCATG
CAGCCGGGCGCGACGACGGCCGAGCAAGCCATGGCAACGATCCTGGGCGACTACGTGGAGAACTACCGAGAGGAC
CTACCGGCGCACGTCGACGCGGCGACGTATCCGCTGGTGCACCTGGCCTACTGGCACTGTCGACTGCTGGTGACG
CTGCTGACGCCCGGGGCGACGGCGGCGGAGAAGATGTGGCCGACGAGGGAGCTGGTCAGCCTGCTGTCGGCAAGC
GCGCAGCTGCGGAGCCCGCTGGTGCACCACTTCGTCTCGCTGGCCGCGCTGTCGCTGTCGAAGCTGGCCAGGGCG
GACGGCACGCGCGAGGAGGCGGCGCGGCTGATTGGCGAGATTGGCGAGACGGCGCCCGGCGGGCACTGGGACGGC
GTGCAGGAGCGGCTGGCGGAGCAGCTGCGGCCGGTGTCGTCGGTGGAGGCGACGGCCAGCCAGGGCCTGCAGCAC
CTGGCCGACCTGGCGACGGCACACGAGGGCATCGCGCCGGGCGAGGGCGAGGCCGTCTTCGGGCCGTCGCTGGCG
GCCGGCTACCTCGACGTGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail